KEGG   Macaca fascicularis (crab-eating macaque): 102145559
Entry
102145559         CDS       T02918                                 

Gene name
CR2
Definition
(RefSeq) complement C3d receptor 2
  KO
K04012  complement receptor type 2
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04610  Complement and coagulation cascades
mcf04640  Hematopoietic cell lineage
mcf04662  B cell receptor signaling pathway
mcf05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102145559 (CR2)
   04610 Complement and coagulation cascades
    102145559 (CR2)
   04662 B cell receptor signaling pathway
    102145559 (CR2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102145559 (CR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102145559 (CR2)
CD molecules [BR:mcf04090]
 Proteins
  102145559 (CR2)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 102145559
NCBI-ProteinID: XP_005540745
UniProt: A0A2K5URA2
Position
1
AA seq 1093 aa
MGAAGLLGVFLALIVPGVLGISCGSPPPILNGRISHYSTPITLGTVIRYICSNGFRLIGE
KNIICITKDKVVGIWDKPAPKCEYFNKYSTCPEPIVPGGYKTRGAEPPYIHGDFVTFACK
TNFSMNGNKSVWCQANSKWGPTRLPTCESVFPLECPALPMIHNGHHTSENVGSIAPGLSV
TYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKPLGRFPNGKVKEPPILQVGVTAN
FFCDEGYQLQGPSSSRCVIAGQGVAWTKMPVCKEIFCPSPPPILNGRHTGNSLANVSYGS
IVTYTCDPDPEEGVNFILIGENTLRCTVDSQKTGTWSGPAPRCELSTSAVQCPRPQVLRG
RIVSGQKDRYTYNDTVIFACTFGFTLKGSKQIRCNAQGTWEPSAPVCEKECQAPPNILNG
QKEDRHMVRFNPGTSIKYSCNPGYVLVGEESIQCTSEGVWTPPVPQCKVAVCEATGKQLL
TKPQHQFIRPDVNSSCDEGYKLSGSVYQECQGRTPWFMEIRLCKEITCPPPPVIYNGAHT
GSSLEDFPYGTTVTYTCNPGPEREVEFSLIGESTIRCTSNDQERGTWSGPAPLCELSLLA
VQCSHVHVANGYKISGKEAPYFYNDTVTFKCFNGFTLKGSSQIRCKANNTWDPEIPVCEK
GCQPPPGLHHGRHTGGNTVFFVSGMTVDYTCDPGYLLVGNKSIHCMPSGNWSPSAPRCEE
TCQPVREDLQELPVGSRVELVNTSCQDGYWLTGHTYHKCQDDENGIWFKKIPLCKVIHCH
PPPVIVNGKHTGMKAENFLYGNEVSYECDQGFYLLGEKKLQCRSDSKGHGSWSGPSPQCL
QSPPVTSCPNPEVKHGYKLNKTLSAYSHDDIVYVDCHPGFIMNGSRVIRCHTDNTWVPGV
PTCIKKAFVGCQPPPKTPNGNHTGGNIARFSPGMSILYSCDQGYLLVGEALLLCTHEGTW
NRPAPHCKEVNCSSPADMDGIQKGLEPRKMYQYGAVVTLECEDGYMLEGSSQSQCQADHQ
WNPPLAVCRSRSLAPVLSGIAAGLILLIFLIVVTLCMISKHRERNYHTNTSQKEAFRLEA
REVYSIDPYNPAS
NT seq 3282 nt   +upstreamnt  +downstreamnt
atgggcgccgcgggcctgctcggggttttcttggctctcatcgtaccaggggtcctcgga
atttcttgtggctctcctcctcctatcctaaatggccgaattagtcattattctaccccc
atcactcttggtactgtgataaggtacatatgttcaaatggcttccgcctcattggagaa
aaaaatataatttgcataactaaagacaaagtggttggaatctgggataaacctgctcct
aaatgtgaatatttcaataaatattctacttgccctgagcccatagtaccaggaggatac
aaaactagaggcgctgaaccaccctacatacatggtgattttgtgacatttgcctgtaaa
accaacttttccatgaacggaaacaagtctgtttggtgtcaggcaaatagtaagtgggga
ccgacacgactaccaacctgtgaaagtgttttccctctggagtgtccagcacttcctatg
atccacaatggacatcacacaagcgagaatgtcggctccattgctccaggattatctgtg
acttacagctgtgaatctggttacttgcttgttggagaaaagatcattaactgtttgtct
tcgggaaaatggagtgctgtcccccccacatgtgaagaggcacgctgtaaacctctagga
cgatttcccaatgggaaggtaaaggagcccccaattctccaagttggtgtaactgcaaac
tttttctgtgatgaagggtatcaactgcaaggcccatcttctagtcggtgtgtaattgct
ggacaaggagttgcttggacaaaaatgccagtatgtaaagaaattttttgcccatcacct
ccccctattctcaatggaagacatacaggcaactcactagcaaatgtctcatatggaagc
atagtcacttacacttgtgacccagacccagaggaaggagtgaacttcatccttattgga
gagaacactctccgttgtacagttgatagtcagaagactgggacctggagtggccctgcc
ccacgctgtgaactttctacttctgcggttcagtgtccacgtccccaggtcctaagaggc
cgaatagtatctgggcagaaagatcgatatacctataacgacactgtgatatttgcttgc
acgtttggcttcactttgaagggcagcaagcaaatccgatgcaatgcccaaggcacgtgg
gagccatctgcaccagtctgtgaaaaggaatgccaggcccctcctaacatcctcaatggg
caaaaagaagatagacacatggtccgctttaaccctggaacatctataaaatatagctgt
aaccctggctatgtgctggtcggagaagaatccatacagtgtacctctgagggggtatgg
acaccccctgtaccccaatgcaaagtggcagtgtgtgaagctacaggaaagcaactcttg
acaaaaccccagcaccaatttattagaccagatgttaactcttcttgcgatgaagggtac
aagttaagtgggagtgtttatcaggagtgtcaaggtagaactccttggtttatggagatt
cgtctttgtaaagaaatcacttgcccaccaccccctgttatctacaatggagcacacacc
gggagttccttagaagattttccatacggaaccacggtcacttacacatgtaaccccggg
ccagaaagagaagtggaattcagcctcattggagagagcaccatccgttgtacaagcaat
gatcaagaaagaggcacctggagtggcccggctcccctatgtgaactttccctccttgct
gtccaatgctcacatgtccatgttgcaaatggatataagatatctggcaaggaagcccca
tatttctacaatgacactgtgacattcaagtgttttaatggatttactttgaagggcagt
agtcagattcgttgcaaagctaataacacctgggatcctgaaataccagtttgtgaaaaa
ggctgccagccacctcctgggctccaccatggtcggcatacaggtggaaatacggtcttc
tttgtctctgggatgactgtagactacacttgtgaccctggctacttgcttgtgggaaac
aaatccattcactgtatgccttcaggaaattggagtccttctgccccgcggtgtgaagaa
acatgccagcctgtgagagaggatcttcaagaacttccagttggttcacgtgtggagcta
gttaatacatcctgccaagatgggtactggttgactggacatacttaccacaagtgtcaa
gatgatgaaaatggaatttggttcaaaaagattccactttgtaaagttattcactgtcac
cctccaccagtgattgtcaatgggaagcacacaggcatgaaggcagaaaactttctatat
ggaaatgaagtctcttatgaatgtgaccaaggattctatctcctgggagagaaaaaattg
cagtgcagaagtgattctaaaggacatggatcttggagtgggccttccccacagtgctta
caatctcctcctgtgactagctgccctaacccagaagtcaaacacgggtacaagctgaat
aaaacgctttctgcatattcccacgatgacatagtgtatgttgactgccatcccggcttc
atcatgaacggtagtcgcgtgattaggtgtcatactgataacacatgggtgccaggtgtg
ccaacttgtatcaaaaaagccttcgtagggtgtcagcctccgcctaagacccccaacggg
aaccatactggtggaaacatagctcggttttcccctggaatgtcaatcctgtacagctgt
gaccaaggctacctgctggtgggagaggcactccttctttgcacacatgagggaacctgg
aaccgacccgcccctcattgtaaagaggtaaactgtagctcaccagcagatatggatgga
atccagaaggggctggaaccgaggaaaatgtatcagtatggagctgttgtaactctggag
tgtgaagatggatatatgctggaaggcagttcccagagccagtgccaggcagatcaccaa
tggaaccctcccctggcggtttgcagatcccgttcacttgctcctgtcctttctggtatt
gctgcaggtttgatacttcttatcttcttgattgttgttaccttatgcatgatatcaaaa
cacagagaacgcaattatcatacaaatacaagccagaaagaagcttttcgtttagaagca
cgagaagtatattctattgatccatacaacccagcaagttga

DBGET integrated database retrieval system