KEGG   Macaca fascicularis (crab-eating macaque): 102145859
Entry
102145859         CDS       T02918                                 

Gene name
RB1
Definition
(RefSeq) RB transcriptional corepressor 1
  KO
K06618  retinoblastoma-associated protein
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01522  Endocrine resistance
mcf04110  Cell cycle
mcf04218  Cellular senescence
mcf04934  Cushing syndrome
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05203  Viral carcinogenesis
mcf05212  Pancreatic cancer
mcf05214  Glioma
mcf05215  Prostate cancer
mcf05218  Melanoma
mcf05219  Bladder cancer
mcf05220  Chronic myeloid leukemia
mcf05222  Small cell lung cancer
mcf05223  Non-small cell lung cancer
mcf05224  Breast cancer
mcf05225  Hepatocellular carcinoma
mcf05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102145859 (RB1)
   04218 Cellular senescence
    102145859 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102145859 (RB1)
   05203 Viral carcinogenesis
    102145859 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102145859 (RB1)
   05225 Hepatocellular carcinoma
    102145859 (RB1)
   05226 Gastric cancer
    102145859 (RB1)
   05214 Glioma
    102145859 (RB1)
   05220 Chronic myeloid leukemia
    102145859 (RB1)
   05218 Melanoma
    102145859 (RB1)
   05219 Bladder cancer
    102145859 (RB1)
   05215 Prostate cancer
    102145859 (RB1)
   05224 Breast cancer
    102145859 (RB1)
   05222 Small cell lung cancer
    102145859 (RB1)
   05223 Non-small cell lung cancer
    102145859 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102145859 (RB1)
   05161 Hepatitis B
    102145859 (RB1)
   05160 Hepatitis C
    102145859 (RB1)
   05163 Human cytomegalovirus infection
    102145859 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102145859 (RB1)
   05169 Epstein-Barr virus infection
    102145859 (RB1)
   05165 Human papillomavirus infection
    102145859 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102145859 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102145859 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcf01009]
    102145859 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcf03000]
    102145859 (RB1)
Protein phosphatases and associated proteins [BR:mcf01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102145859 (RB1)
Transcription factors [BR:mcf03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    102145859 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 TFIIB
Other DBs
NCBI-GeneID: 102145859
NCBI-ProteinID: XP_005585892
UniProt: A0A2K5UC26
Position
17
AA seq 928 aa
MPPKTPRKTAAAAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTAL
CQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMPFTFTEL
QKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSS
ISTEINSTLVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPVLLKEPYK
TAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFM
NSLGLVTSNGLPEVESLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKS
NLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVK
DIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDN
IFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEG
NLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHFESACPLNLPLQNNH
TAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYL
RLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLK
FKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLS
PIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG
TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK
LAEMTSTRTRMQKQKMNDSMDTSNKEEK
NT seq 2787 nt   +upstreamnt  +downstreamnt
atgccgcccaaaaccccccgaaaaacggccgccgccgccgccgccgctgccgcggaaccc
ccggcaccgccgccgccaccccctcctgaggaggacccagagcaggacagcggtccggag
gacctgcctctggtcaggcttgagtttgaagaaaccgaagaacctgattttactgcgtta
tgtcagaaattaaagataccagatcatgtcagagagagagcttggttaacttgggagaaa
gtttcatctgtggatggagtattgggaggttatattcaaaagaaaaaagaactgtgggga
atatgtatctttattgcagcagttgacctagatgagatgccattcacttttactgagcta
cagaaaaacatagaaatcagtgtccataaattctttaacttactaaaggaaattgatact
agtaccaaagttgataatgctatgtcaagactattgaagaagtatgatgtattgtttgca
ctcttcagcaaattggaaaggacatgtgaacttatatatttgacacaacccagcagttcg
atatctactgaaataaattctacattggtgctaaaagtttcttggatcacatttttatta
gctaaaggggaagtattacaaatggaagatgatctggtgatttcatttcagttaatgcta
tgtgtccttgactattttattaaactctcacctcctgtgttgctcaaagaaccatataaa
acagctgttatacccattaatggttcacctcgaacacccaggcgaggccagaacaggagt
gcacggatagcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaagaa
catgaatgtaatatagatgaggtgaaaaatgtttatttcaaaaattttataccttttatg
aattctcttggacttgtaacatctaatggacttccagaggttgaaagtctgtctaaacga
tatgaagaaatttatcttaaaaataaagatctagatgcaagattatttttggatcatgat
aagactcttcagactgattctatagacagttttgaaacacagagaacaccgcgaaaaagt
aaccttgatgaagaggtgaatgtgattcctccacacactccagttaggactgttatgaac
actatccaacaattaatgatgattttaaattcagcaagtgatcaaccttcagaaaatctg
atttcctattttaataactgcacagtgaatccaaaagaaagcatactgaaaagagtgaag
gatataggatacatctttaaagagaaatttgctaaagctgtgggacagggatgtgtcgaa
attggatcacagcgatacaaacttggagttcgcttgtattaccgagtaatggaatccatg
cttaaatcagaagaagaacgattatccattcaaaattttagcaaacttctgaatgacaac
atttttcatatgtctttattggcgtgtgctcttgaggttgtaatggccacatatagcaga
agtacatctcagaatcttgattctggaacagatttgtctttcccatggattctgaatgtg
cttaatttgaaagcctttgatttttacaaagtgattgaaagttttatcaaagcagaaggc
aacttgacaagagaaatgataaaacacttagaacgatgtgaacatcgaatcatggaatcc
cttgcatggctctcagattcacctttatttgatcttattaaacaatcaaaggaccgagaa
ggaccaactgatcactttgaatctgcttgtcctcttaatcttcctctccagaataatcac
actgcagcagatatgtatctttctcctgtaagatctccaaagaaaaaaggttcaactaca
cgtgtaaattctactgcaaatgcagagacacaagcaacctcagccttccagacccagaag
ccattgaaatctacctctctttcactgttttataaaaaagtgtatcggctagcctatctc
cggctaaatacactatgtgaacgccttctatctgagcacccagaactagaacacatcatc
tggacccttttccagcatacgctgcagaatgagtatgaactcatgagagacaggcatttg
gaccaaattatgatgtgttccatgtatggcatatgcaaagtgaagaatatagaccttaaa
ttcaaaatcatcgtaacagcatacaaggatcttcctcatgctgttcaggagacattcaaa
cgtgttttgatcaaagaagaggagtatgattctattatagtattctataactcggtcttc
atgcagagactgaaaacaaatattttgcagtatgcttccaccaggccccctaccttgtca
ccaatacctcacattcctcgaagtccttacaagtttcctagttcgcccttacggattcct
ggagggaacatctatatttcacccctgaagagtccatataaaatttcagaaggtctgcca
acacccacgaaaatgactccaagatcaagaatcttagtatcaattggtgaatcatttggg
acttctgagaagttccagaaaataaatcagatggtgtgtaacagcgaccgtgtgctcaaa
agaagtgctgaaggaagcaaccctcctaaaccgctgaaaaaactacgctttgatattgaa
ggatcagatgaagcagatggaagtaaacatctcccaggggagtccaaatttcagcagaaa
ctggcagaaatgacttccactcgaacacgaatgcaaaagcagaaaatgaatgatagcatg
gatacctcaaacaaggaagagaaatga

DBGET integrated database retrieval system