KEGG   Macaca fascicularis (crab-eating macaque): 102147198
Entry
102147198         CDS       T02918                                 

Gene name
FCGR1A, Fcgr1
Definition
(RefSeq) Fc fragment of IgG, high affinity Ia, receptor (CD64)
  KO
K06498  high affinity immunoglobulin gamma Fc receptor I
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04380  Osteoclast differentiation
mcf04613  Neutrophil extracellular trap formation
mcf04640  Hematopoietic cell lineage
mcf04666  Fc gamma R-mediated phagocytosis
mcf05140  Leishmaniasis
mcf05150  Staphylococcus aureus infection
mcf05152  Tuberculosis
mcf05202  Transcriptional misregulation in cancer
mcf05221  Acute myeloid leukemia
mcf05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102147198 (FCGR1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102147198 (FCGR1A)
   04613 Neutrophil extracellular trap formation
    102147198 (FCGR1A)
   04666 Fc gamma R-mediated phagocytosis
    102147198 (FCGR1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102147198 (FCGR1A)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102147198 (FCGR1A)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102147198 (FCGR1A)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102147198 (FCGR1A)
   05152 Tuberculosis
    102147198 (FCGR1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102147198 (FCGR1A)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    102147198 (FCGR1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcf04131]
    102147198 (FCGR1A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102147198 (FCGR1A)
Membrane trafficking [BR:mcf04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    102147198 (FCGR1A)
CD molecules [BR:mcf04090]
 Proteins
  102147198 (FCGR1A)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set I-set Ig_4 PIRT C2-set
Other DBs
NCBI-GeneID: 102147198
NCBI-ProteinID: NP_001270969
Position
1
AA seq 374 aa
MWFLTALLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLQCEVPRLPGSSSTQWFLNG
TATQTSTPSYRITSASVKDSGEYRCQRGPSGRSDPIQLEIHRDWLLLQVSSRVFTEGEPL
ALRCHAWKDKLVYNVLYYQNGKAFKFFYRNSQLTILKTNISHNGAYHCSGMGKHRYTSAG
VSVTVKELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPGLQLYFSFYMGSKTLRGRN
TSSEYQILTARREDSGFYWCEATTEDGNVLKRSPELELQVLGLQLPTPVWLHVLFYLVVG
IMVLVNTGLWVTIRKELKRKKKWNLEISLDSAHEKKVTSSLQEDRHLEEELKSQEQEKEQ
LQEGVHRKEPEEAK
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtggttcttgacagctctgctcctttgggttccagttgatgggcaagtggataccaca
aaggcagtgatcactttgcagcctccatgggtcagcgtgttccaagaggaaactgtaacc
ttacagtgtgaggtgccccgtctgcctgggagcagctccacacagtggtttctcaatggc
acagccactcagacctcgactcccagctacagaatcacctctgccagtgtcaaggacagt
ggtgaatacaggtgccagagaggtccctcagggcgaagtgaccccatacagctggaaatc
cacagagactggctactactgcaggtatccagcagagtcttcacagaaggagaacctctg
gccttgaggtgtcatgcatggaaggataagctggtgtacaatgtgctttactatcaaaat
ggcaaagcctttaagtttttctaccggaattctcaactcaccattctgaaaaccaacata
agtcacaacggcgcctaccactgctcaggcatgggaaagcatcgctacacatcagcagga
gtatctgtcactgtgaaagagctatttccagctccagtgctgaatgcatccgtgacatcc
ccgctcctggaggggaatctggtcaccctgagctgtgaaacaaagttgcttctgcagagg
cctggtttgcagctttacttctccttctacatgggcagcaagaccctgcgaggcaggaac
acgtcctctgaataccaaatactaactgctagaagagaagactctgggttttactggtgc
gaggccaccacagaagacggaaatgtccttaagcgcagccctgagttggagcttcaagtg
cttggcctccagttaccaactcctgtctggcttcatgtccttttctatctggtagtggga
ataatggttttagtgaacactggtctctgggtgacaatacgtaaagaactgaaaagaaag
aaaaagtggaatttagaaatctctttggattctgctcatgagaagaaggtaacttccagc
cttcaagaagacagacatttagaagaagagctgaagagtcaggaacaagaaaaagaacag
ctgcaggaaggggtgcaccggaaggagcctgaggaggccaagtag

DBGET integrated database retrieval system