KEGG   Mesorhizobium ciceri biovar biserrulae: Mesci_2030
Entry
Mesci_2030        CDS       T01401                                 

Name
(GenBank) hypothetical protein
  KO
K18610  4-pyridoxolactonase [EC:3.1.1.27]
Organism
mci  Mesorhizobium ciceri biovar biserrulae
Pathway
mci00750  Vitamin B6 metabolism
mci01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mesci_2030
Enzymes [BR:mci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.27  4-pyridoxolactonase
     Mesci_2030
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2
Other DBs
NCBI-ProteinID: ADV11183
UniProt: E8TGY4
Position
2133290..2134096
AA seq 268 aa
MSDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMK
VLPFEKPIQEKHQTIPGALALLGLEPKDIDVVVNSHFHFDHCGGNKYFPHAKKICHRTEV
PQACNPEPFEHLGYSDLSFSAEAAEARGATGQLLAGTTRANSTFEGIDGDVELARGVRLI
STPGHSIGHYSLLVEFPKRKPIMFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKL
AEDHGAELMYSHDMDNFKTYKTGTQFYG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtcggataccaaggtctacctgctcgacggcggctcgctcgttctcgacggatatcat
gtgttctggaaccgcggccctggcggcgaagtgcgcttcccggtctattcgatcctgatc
gaacatgccgagggccggttcctcatcgacaccggctatgactatgatcacgtgatgaag
gtgctgccgttcgaaaagccgatccaggaaaagcaccagaccatcccaggcgccctggcg
ctgctcggcctcgaaccgaaggacatcgacgtcgtcgtcaattcgcatttccacttcgat
cattgcggcggcaacaagtattttccgcacgccaagaagatctgccaccggaccgaggtg
ccgcaggcctgcaatcccgaacctttcgagcatctcggctattccgatctgagtttttcg
gcggaggctgccgaagcgcgtggcgcgaccgggcaattgcttgcgggaacgacacgggcg
aattcgacctttgaaggcatcgatggtgacgtcgagcttgccaggggcgtccggctgatc
tcgacgcccggccattcgatcggccattacagcctgctggtcgagttccccaagcgcaag
ccgatcatgttcacgatcgatgcggcctatacgcagaagagcctcgagacgctgtgccag
gcggccttccacatcgatccggtggcgggcgtcaattcgatgcgcaaggtgaagaaactc
gccgaagaccatggcgccgagctgatgtactcgcacgacatggacaacttcaagacctac
aagaccggtacgcaattctacggctga

DBGET integrated database retrieval system