KEGG   Micromonospora craniellae: ID554_11945
Entry
ID554_11945       CDS       T06957                                 

Definition
(GenBank) class I SAM-dependent methyltransferase
  KO
K13311  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.234]
Organism
mcra  Micromonospora craniellae
Pathway
mcra00523  Polyketide sugar unit biosynthesis
mcra01100  Metabolic pathways
mcra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcra00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    ID554_11945
Enzymes [BR:mcra01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.234  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     ID554_11945
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_31 NodS Ubie_methyltran MetW DREV
Other DBs
NCBI-ProteinID: QOC94997
Position
complement(2692729..2693418)
AA seq 229 aa
MRHRGRDHTAEAATLARTVRRRNPAAASLLDVACGTGLHLEHLRTHFAPVTGVDLSAEML
ARAGARVPDVALHEGDMRELNLDAAFDVVVCLFAVPHLRGAAELDRTVARLRAHLTPGGV
LVVEPWYTPEALVPGYVARDMVQEQDRVVVRLSHSTWLDDARDRIRMTVHQAYADPEAGI
RHDTATTELTLFRPEHFAAAFARAGLAASHVTAPPFRWGLWIARPADAR
NT seq 690 nt   +upstreamnt  +downstreamnt
atgcggcaccggggccgcgaccacacggccgaggccgccacgctcgcccggacggtccgg
cggcggaaccctgccgccgcctcgctgctcgacgtggcctgcggcaccgggctgcacctg
gagcacctgcggacccacttcgcgccggtgaccggggtggacctgtccgcggagatgctc
gcccgcgccggcgcccgggtgcccgacgtggccctgcacgagggcgacatgcgcgagctg
aacctggatgcggccttcgacgtcgtggtctgcctcttcgcggtgccgcacctgcgcggc
gccgccgaactggaccggaccgtcgcgcggctgcgcgcccacctgacgccgggcggcgtg
ctggtggtcgagccctggtacacgcccgaggcgctcgtccccggctacgtggcccgtgac
atggtgcaggagcaggaccgggtggtggtccggctgtcccactcgacgtggctcgacgac
gcgcgcgaccgcatccggatgaccgtgcaccaggcgtacgccgacccggaggcgggcatc
cggcacgacaccgcgacgaccgagctgacgctgttccggccggagcacttcgccgccgcg
ttcgcccgcgccgggctcgccgcctcgcacgtcacggcgccgccgttccgctggggcctg
tggatcgcccggccggcggacgcccgatga

DBGET integrated database retrieval system