KEGG   Methanobacterium congolense: MCBB_0998
Entry
MCBB_0998         CDS       T04503                                 
Name
(GenBank) putative protein MTH_386
  KO
K14094  energy-converting hydrogenase A subunit C
Organism
mcub  Methanobacterium congolense
Brite
KEGG Orthology (KO) [BR:mcub00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    MCBB_0998
SSDB
Motif
Pfam: DUF2109 DUF2231 MbhD CarS-like DUF5699 COX7a
Other DBs
NCBI-ProteinID: SCG85558
UniProt: A0A1D3L1W2
Position
I:1034551..1034799
AA seq 82 aa
MLMEILGIIIVVMALRTLFARDRSERMLYLNVIGFALSAMIALYIQTPFGAIMAITFFIT
STLSSNAIAYSIGRVKEEIIKE
NT seq 249 nt   +upstreamnt  +downstreamnt
atgttgatggagatcctgggcatcataatagtggtgatggctttaagaaccctttttgca
agggacagatctgagagaatgctttacctaaacgtcataggttttgcactgtctgcaatg
atagctctctacattcagacacctttcggtgctataatggcaataacgttctttataacc
tctactttaagctcaaacgcaatagcttactcaattggaagggtgaaagaggagatcata
aaggagtga

DBGET integrated database retrieval system