Methylomonas sp. EFPC3: PL263_09295 Help Entry PL263_09295       CDS       T10335                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism meec  Methylomonas sp. EFPC3 Brite KEGG Orthology (KO) [BR:meec00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:meec03032]     PL263_09295    03036 Chromosome and associated proteins [BR:meec03036]     PL263_09295    03400 DNA repair and recombination proteins [BR:meec03400]     PL263_09295 DNA replication proteins [BR:meec03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PL263_09295 Chromosome and associated proteins [BR:meec03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PL263_09295 DNA repair and recombination proteins [BR:meec03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PL263_09295 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-CCDC81_euk_2 Lmo2446-like_N HU-DNA_bdg Motif Other DBs NCBI-ProteinID:  WFP52204 Position complement(2104394..2104666) Genome browser AA seq 90 aa AA seqDB search MNKSELIDAIASASQLTKADAGRALDGFIKAVEDALKQGDSVALVGFGTFDVKERAERKG RNPQTGEEITIKAAKIPSFKAGKSLKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaatcggaacttattgacgctattgccagtgcgtcacagttgacaaaagccgat gctggtcgggctctggatggttttatcaaagccgttgaagacgcattgaaacaaggcgat tccgttgccctggttggtttcggtactttcgatgttaaagaaagagcggaacgtaaaggc cgcaacccgcaaaccggcgaagagatcaccattaaagccgcaaaaattccttcatttaaa gctggcaaatctttaaaagatgctgtaaactag

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (7) Pfam (7) All databases (8) Download RDF

DBGET integrated database retrieval system