KEGG   Methanosarcina sp. WH1: MSWH1_3072
Entry
MSWH1_3072        CDS       T03851                                 

Name
(GenBank) methylamine methyltransferase corrinoid protein reductive activase
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
mef  Methanosarcina sp. WH1
Brite
KEGG Orthology (KO) [BR:mef00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MSWH1_3072
Enzymes [BR:mef01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     MSWH1_3072
SSDB
Motif
Pfam: RACo_C_ter Raco_middle Fer4 Fer4_6 Fer4_21 Fer4_7 Fer4_9 Fer4_10 Fer4_2 Fer4_16 Fer4_17 Fer4_4 Fer4_8 Fer4_13
Other DBs
NCBI-ProteinID: AKB23343
UniProt: A0A0E3KZT7
Position
complement(3755243..3756868)
AA seq 541 aa
MYGIALDLGTSGFRAQFIDLETNETLKTVITMGHPLPGGNVMDHLDFAITTGEDVAHGVI
IETIRRMFLKFDADLSKVERLAVCGNPIQLSLFQNIEIRDLAYAGENKQKMLGVQDVKRD
ARVFPASELFGDTDLPNCEVIVPPAIRHEIGADALAMMLETDFLSQTEPALVTDYGTNAE
MALKVGDRIITASAAAGPAIEGQGISSGMLASPGAICDVKPEGEYWKIIVLDKEMEKQDA
YLIHPVTGEIKESYGGETVGITGTGVISAFSLAMRSGLITKSPKLPNGKLILGPGIEITE
KDVEEAGKAIGAIRAAHMTLIVESGIKYEDLEYAYMSGASGAYVDAEASRRLGATPGYAK
KIVQFGNTSLALARELVLNRSRLEDVIEIAKRITADHLMMATSETFNNFYLCELSYWTMG
MPLEMYDQMLELYGLPKLPKTLEHAIIEKRVSKDIEHVGVGGLAILKEIGIILEVPVDKC
IYCLKCVEECPEDALEIVETDGKMIAKYDSQKCLGTSCRRCVSICPEEAIDITKLRITGA
K
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgtacggaatagcacttgatctgggtaccagcggttttagagcccagtttattgatctt
gaaacgaatgaaactttaaaaacagtcataaccatgggtcatcctctccccggaggaaat
gtcatggatcacctggattttgcaatcacaacaggtgaggatgtggctcatggagtaatt
atcgaaactatcaggagaatgttcctgaaattcgatgcagacctttctaaagtagaaaga
cttgcagtctgcggaaaccctatccagctttcccttttccagaacatagaaatcagggat
ctggcatacgcaggggaaaacaagcagaaaatgctcggagtccaggatgtaaaaagagat
gcccgtgtgtttccagcctcagagcttttcggggatacggacctgcctaactgtgaagtt
atcgtgccccccgcaatcaggcatgagatcggagcagacgcccttgccatgatgctggaa
actgatttccttagccagaccgaacctgcacttgttaccgattacgggacaaacgccgaa
atggccctgaaggttggggacaggattatcacggcaagtgctgccgcaggccctgcgatt
gaagggcagggcataagttccggcatgcttgcaagccccggggctatctgtgacgtgaaa
cccgagggcgaatactggaaaattatagtccttgataaggagatggaaaagcaggatgcc
taccttatccatccggtcacaggcgagattaaggagtcctatggtggggaaaccgtgggc
atcacaggtaccggggtaatctcggctttttccctggccatgagaagcgggctgataact
aaatctccgaaacttcccaatgggaagctgattcttggccctggaattgaaatcactgaa
aaagatgtggaagaagccggaaaggccataggggcgatccgtgcagctcacatgactctc
attgtggagtccggaataaagtatgaagaccttgagtatgcatacatgtcaggggcttcc
ggagcctatgtagacgctgaagcttcccgcaggctcggggccaccccgggttatgccaaa
aaaattgtccagttcggaaacacctctcttgctcttgcacgggaacttgttctgaacagg
tccaggctggaggatgttatcgagattgcaaaaagaattactgccgatcacctcatgatg
gcgaccagcgagaccttcaataacttctatctctgcgaactctcctactggaccatggga
atgccgcttgaaatgtacgaccagatgcttgaactctacgggttgcccaaactcccgaaa
accctggaacacgccattatcgaaaagcgagtcagcaaggatatagaacatgtcggagtt
ggcgggcttgccatcctcaaagaaataggcataatcctcgaagtccctgtggataagtgc
atctactgcctgaaatgcgtagaagaatgccctgaagacgccctcgaaatcgtcgaaacc
gatggcaaaatgatcgcaaaatacgacagccagaaatgcctcggcacaagctgccgccgt
tgtgtgagcatctgccctgaagaggccatcgacatcaccaaactccgcatcaccggcgca
aaataa

DBGET integrated database retrieval system