KEGG   Methanobacterium lacus: Metbo_1288
Entry
Metbo_1288        CDS       T01437                                 
Name
(GenBank) Protein of unknown function DUF2109, membrane
  KO
K14094  energy-converting hydrogenase A subunit C
Organism
mel  Methanobacterium lacus
Brite
KEGG Orthology (KO) [BR:mel00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    Metbo_1288
SSDB
Motif
Pfam: DUF2109 CTP_transf_1 COX7a
Other DBs
NCBI-ProteinID: ADZ09530
UniProt: F0T710
Position
complement(1287418..1287669)
AA seq 83 aa
MLIEILGIIVLLMALRTLIAEDRAARLLYLNVIGFALSGMIALYIQTPFGAIIAITFFIC
STLSANAIAYSIGRNKREIVLDD
NT seq 252 nt   +upstreamnt  +downstreamnt
atgctaatcgaaatattaggtatcattgtactattaatggctctaagaacattaattgca
gaagatagagcagctaggttactttaccttaacgttataggttttgcactatctggaatg
atagcactctatatacaaacaccattcggagcaataatagcaataactttctttatttgc
tccactttaagtgcaaatgccatagcatattccataggaagaaataaacgggagatagtt
ctcgacgattga

DBGET integrated database retrieval system