KEGG   Mesorhizobium erdmanii: EB233_11055
Entry
EB233_11055       CDS       T06791                                 

Name
(GenBank) N-acyl homoserine lactonase family protein
  KO
K18610  4-pyridoxolactonase [EC:3.1.1.27]
Organism
merd  Mesorhizobium erdmanii
Pathway
merd00750  Vitamin B6 metabolism
merd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:merd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    EB233_11055
Enzymes [BR:merd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.27  4-pyridoxolactonase
     EB233_11055
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2
Other DBs
NCBI-ProteinID: QKC76010
UniProt: A0A6M7UIP9
Position
2265094..2265900
AA seq 268 aa
MSDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMK
VLPFEKPIQEKHQTIPGALALLGLEPKDIDVVVNSHFHFDHCGGNKYFPHAKKICHRTEV
PQACNPQPFEHLGYSDLSFSAEAAEARGATGQLLAGTTRANSTFEGIDGDVDLARGVKLI
STPGHSIGHYSLLVEFPKRKPIMFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKL
AEDHGAELMYSHDMDNFKTYRTGTQFYG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtcggataccaaggtctacctgctcgacggcggctcgctcgttctcgacgggtatcat
gtgttctggaatcgcggccctggcggcgaggtgcgcttccccgtctattcgatcctgatc
gaacatgccgagggccgtttcctcatcgacacaggctacgactacgatcatgtgatgaag
gtgctgccgttcgaaaagccgattcaggaaaagcaccagaccattcccggcgccctggcg
ctgctcggcctcgagccgaaggacatcgacgtcgtcgtcaattcgcatttccacttcgac
cattgcggcggcaacaagtattttccgcacgccaagaagatctgccaccggaccgaggtg
ccgcaggcctgcaatccgcagcccttcgaacatctgggctattccgacctgagcttttcg
gcggaggcggccgaagcgcgtggagcgaccgggcaattgcttgcgggaacgacacgggcg
aattcgaccttcgagggtatcgacggcgacgtcgaccttgccaggggcgtcaagctgatc
tcgacgcccggccattcgatcggtcattacagcctgctcgtggagttccccaagcgcaag
ccgatcatgttcacgatcgatgccgcctacacgcagaagagccttgaaacgctgtgccag
gcggccttccacatcgatccggtggcgggcgtcaattcgatgcgcaaggtgaagaaactc
gccgaggaccatggcgccgagctgatgtattcgcacgacatggacaacttcaagacctac
cggacaggcacgcaattctacggctga

DBGET integrated database retrieval system