KEGG   Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2: EJ066_21290
Entry
EJ066_21290       CDS       T05904                                 

Name
(GenBank) N-acyl homoserine lactonase family protein
  KO
K18610  4-pyridoxolactonase [EC:3.1.1.27]
Organism
mesm  Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2
Pathway
mesm00750  Vitamin B6 metabolism
mesm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mesm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    EJ066_21290
Enzymes [BR:mesm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.27  4-pyridoxolactonase
     EJ066_21290
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2
Other DBs
NCBI-ProteinID: AZN99452
UniProt: A0A3S9BL17
Position
4427651..4428457
AA seq 268 aa
MSDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMK
VLPFEKPIQEKHQTIPGALALLGLEPKDIDVVVNSHFHFDHCGGNKYFPHAKKICHRTEV
PQACNPQPFEQLGYSDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLARGVRLI
STPGHSIGHYSLLVEFPKRKPIMFTIDAAYTQKSLETLCQASFHIDPVAGVNSMRRVKKL
AEDHGAELMYSHDMENFKTYKTGTQFYG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtcggataccaaggtctacctgctcgacggcggctcgctcgttctcgacggctatcac
gtgttctggaatcgcggccccggcggcgaagtgcgctttcctgtttattcgatcctgatc
gagcatgccgagggacggtttctcatcgacaccggctacgactacgatcacgtcatgaag
gtgctgcctttcgaaaagccgatccaggaaaagcaccagaccatccccggcgccctggcg
ctgctcggcctcgagccgaaggacatcgacgtcgtcgtcaactcgcatttccatttcgac
cattgcggcggcaacaagtattttccgcatgccaagaagatctgtcaccggaccgaggta
ccccaggcctgcaatccccagcctttcgagcaactcggctattcggacctgagcttttcg
gccgaggctgccgaagcgcgtggcgcgaccgcgcaattgctggaaggcacgacgcgcgcc
aactcgaccttcgagggcatcgacggcgacgtcgaccttgccaggggcgtcaggttgatc
tcgacgcccggccactcgatcggccactacagcctgctggtggagttccccaagcgcaag
ccgatcatgttcacgatcgatgcggcctacacgcagaagagccttgaaacgctgtgccag
gcgtcctttcacatagacccggtagcgggcgtcaattcgatgcgcagggtgaagaagctc
gccgaggaccatggtgccgagctgatgtattcgcacgacatggaaaacttcaaaacctac
aagaccggcacgcaattctacggctga

DBGET integrated database retrieval system