KEGG   Mesorhizobium sp. Pch-S: C1M53_04555
Entry
C1M53_04555       CDS       T05918                                 

Name
(GenBank) N-acyl homoserine lactonase family protein
  KO
K18610  4-pyridoxolactonase [EC:3.1.1.27]
Organism
mesp  Mesorhizobium sp. Pch-S
Pathway
mesp00750  Vitamin B6 metabolism
mesp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mesp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    C1M53_04555
Enzymes [BR:mesp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.27  4-pyridoxolactonase
     C1M53_04555
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2
Other DBs
NCBI-ProteinID: QAZ42348
UniProt: A0A4P6H701
Position
complement(976738..977544)
AA seq 268 aa
MSDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGFDYDHVMK
VLPFEKPIQEKHQTIPGALALLGLEPKDIDVVVNSHFHFDHCGGNKYFPHAKKICHRTEV
PQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLAGTTRANSTFEGIDGDVELAKGVRLI
STPGHSIGHYSLLVEFPKRQPILFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVQKL
AQDHGAELMYSHDMDNFKTYRTGTQFYG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtcggataccaaggtctacctgctcgacggcggctcgctcgtcctcgacggctatcat
gtgttctggaaccgcggcccgggcggtgaagtccgctttccggtctattcgatcctgatc
gagcatgccgagggccgcttcctcatcgacaccggcttcgactacgaccacgtcatgaag
gtgctgcctttcgaaaagccgatccaggaaaagcaccagaccattccgggcgcgctggcg
ctgctcgggctggagccgaaggacatcgacgtcgtcgtcaattcgcatttccatttcgat
cattgcggcggcaacaaatatttcccgcacgccaagaagatttgccatcgcacggaagtg
ccgcaggcttgcaatccgcagcccttcgaacatctcggctattcggacctgagcttctcg
gcggaggcggcggaagcgcgcggcgcgacggcgcaactgctggcgggcaccacgcgcgcc
aattcgaccttcgaggggatcgatggcgacgtcgaacttgcgaaaggtgtcaggctgatc
tcgacgccgggtcattcgatcggccactacagtcttctggtcgagttccccaagcgccag
ccgatcctgttcacgatcgacgccgcctacacccagaagagcctggagacgctgtgccag
gccgccttccacatcgacccggtcgcgggcgtcaattcgatgcgcaaggtgcagaagctg
gcgcaggatcatggtgctgagctgatgtactcgcacgacatggacaatttcaaaacttac
aggaccggcacgcagttctacggctga

DBGET integrated database retrieval system