KEGG   Mesorhizobium sp. WSM1497: A9K65_010590
Entry
A9K65_010590      CDS       T04915                                 

Name
(GenBank) MBL fold metallo-hydrolase
  KO
K18610  4-pyridoxolactonase [EC:3.1.1.27]
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw00750  Vitamin B6 metabolism
mesw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    A9K65_010590
Enzymes [BR:mesw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.27  4-pyridoxolactonase
     A9K65_010590
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2
Other DBs
NCBI-ProteinID: ARP63776
UniProt: A0A1W6X4U5
Position
2181424..2182230
AA seq 268 aa
MSDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMK
VLPFEKPIQEKHQTIPGALALLGLEPKDIDVVVNSHFHFDHCGGNKYFPHAKKICHRTEV
PQACNPEPFEHLGYSDLSFSAEAAEARGATGQLLAGTTRANSTFEGIDGDVELARGVRLI
STPGHSIGHYSLLVEFPKRKPIMFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKL
AEDHDAELMYSHDMDNFKTYKTGTQFYG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtcggataccaaggtctacctgctcgacggcggctcgctcgttctcgacggctatcat
gtgttctggaaccgcggccctggcggcgaagtgcgcttcccggtctattcgatcctgatc
gaacatgccgagggccggttcctcatcgacaccggctacgactacgatcacgtgatgaag
gtgctgccgttcgaaaagccgatccaggaaaagcaccagaccattcccggtgcgctggcg
ctgctcggcctcgagccgaaggacatcgacgtcgtcgtcaattcgcatttccacttcgat
cattgcggcggcaacaagtattttccgcacgccaagaagatctgccaccggaccgaggtg
ccgcaggcgtgcaatcccgaacctttcgagcatctcggctattccgatctgagtttttcg
gcggaggctgccgaagcgcgtggcgcgaccgggcaattgcttgcgggaacgacacgggcg
aattcgacctttgaaggcatcgatggtgacgtcgagcttgccaggggcgtccggctgatc
tcgacgcccggccattcgatcggccattacagcctgctggtcgagttccccaagcgcaag
ccgatcatgttcacgatcgatgcggcctatacgcagaagagcctcgagacgctgtgccag
gcggccttccacatcgatccggtggcgggcgtcaattcgatgcgcaaggtgaagaaactc
gccgaagaccatgacgccgagctgatgtactcgcacgacatggacaacttcaagacctac
aagaccggcacgcaattctacggctga

DBGET integrated database retrieval system