KEGG   Methanobacterium sp. MB1: MBMB1_1112
Entry
MBMB1_1112        CDS       T02957                                 
Name
(GenBank) putative membrane protein
  KO
K14094  energy-converting hydrogenase A subunit C
Organism
meth  Methanobacterium sp. MB1
Brite
KEGG Orthology (KO) [BR:meth00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    MBMB1_1112
SSDB
Motif
Pfam: DUF2109 DUF5699
Other DBs
NCBI-ProteinID: CDG65213
UniProt: U6EDP9
Position
1093813..1094061
AA seq 82 aa
MLIKILGIIVVLMALRTLIAQNRAERLLYLNVIGFSISAMIGLYINTPFGAIIAITFFVT
ATLSSNAIAYSLGRVKEEIMVK
NT seq 249 nt   +upstreamnt  +downstreamnt
atgttaatcaaaatactagggataatcgtggtgcttatggcactacgcacacttatagct
caaaaccgagccgagcgtttactgtatcttaatgttatcggttttagcatatctgccatg
attggtttatacataaatacaccatttggagcaataattgccatcacattctttgtgact
gctacactcagctccaatgccattgcctattccttaggaagggtaaaagaagagattatg
gtgaaataa

DBGET integrated database retrieval system