KEGG   Methanosarcina sp. MTP4: MSMTP_3125
Entry
MSMTP_3125        CDS       T03850                                 

Name
(GenBank) formate hydrogenlyase complex iron-sulfur subunit
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
metm  Methanosarcina sp. MTP4
Brite
KEGG Orthology (KO) [BR:metm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MSMTP_3125
Enzymes [BR:metm01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     MSMTP_3125
SSDB
Motif
Pfam: RACo_C_ter Raco_middle Fer4 Fer4_6 Fer4_21 Fer4_7 Fer4_9 Fer4_16 Fer4_10 Fer4_17 Fer4_2 Fer4_3 Fer4_8 Fer4_4
Other DBs
NCBI-ProteinID: AKB26594
UniProt: A0A0E3NZT6
Position
complement(4056396..4058081)
AA seq 561 aa
MPDASKSCTLRENIEENKKMYGIALDLGTSGFRAQLIELETKETIKTVITMGHPLPGGNV
MDHLDFAISTGEDVAHAVILETIRRMFLKFDIDFSEVERLAVCGNPIQLSLFQNIEIRDL
AYAGENKQKKLGVENVKRDARVFPASELFKDLDMPNCEVIVPPAIKHEIGADALAMMLET
DFLNQTKPALVTDYGTNAEMALKIGERIITASAAAGPAIEGQGISCGMLASPGAICDVKP
EGEYWRIIVLDKEMEKRDAYLINPLTGDIKEFYGYEAVGITGTGVISAFALALKSGLIEK
SPSLPNGRLVLGPDIEITEKDVEEAGKAIGAIRAAHLTLIVDSGIKYEDLEYAYMSGASG
AYADAEDARQLGAAPGFAKNIVQFGNTSLALARELVMDRSRLEDVIKIAKRITADHLMMA
TSETFNNFYLCELSYWTQGMPLEMYNQMLEMYGIPVLPETLEHASIERRVSKDIEEVGAE
GLAILKEIGINLEVPVSKCIYCHKCEKECPENAIEIIEDAEGKRTARYDSQKCLGTSCRR
CVNICPEGAIEMSNLQIKEAK
NT seq 1686 nt   +upstreamnt  +downstreamnt
gtgccggatgcctcgaaatcatgcacacttcgggaaaacattgaggagaataaaaaaatg
tacggcatagcacttgatttgggtacgagcggttttcgagcacagcttattgagcttgaa
acgaaagaaaccattaaaacggttattaccatggggcaccccctgcccggtggaaatgtc
atggatcaccttgactttgcgatctcaaccggagaggatgtggcccatgcggtgatactg
gaaaccatcaggagaatgttccttaaattcgatattgacttctccgaagtagagcggctg
gctgtttgcggaaaccctatccagctttcccttttccagaacatagaaatcagggacctt
gcatacgccggagaaaacaagcagaaaaagctgggcgtggaaaatgtaaaaagagacgcc
cgtgtgttcccagcttccgagctctttaaagacctggatatgcctaactgcgaagttatc
gtccctcccgcaatcaagcatgagatcggggcagacgccctggcaatgatgcttgaaact
gacttcctgaaccagactaaacctgctcttgttactgattacgggacaaatgccgagatg
gccctgaagatcggggagcggataatcacggcaagtgcagctgccggtcctgccattgaa
ggacagggaataagctgcgggatgctcgcaagccccggagcgatctgcgatgtaaagccc
gaaggggagtactggaggattattgtccttgacaaggagatggaaaaaagggacgcttat
ctcattaatcctctcaccggggacataaaggagttctacggctacgaagctgtgggcata
acgggcaccggtgtgatctcggcttttgctctggcgctgaaaagcggccttatcgaaaag
tccccgtccctgccaaacggcagactggtccttggccctgatatcgaaatcaccgaaaag
gatgtggaagaagccggaaaagcaattggggcaatcagggcagcccaccttacccttatc
gtggactccggcatcaagtatgaagacctggaatacgcttacatgtccggagcctccggg
gcttatgcggatgccgaagatgcccgccagctcggggctgcccctggttttgcaaagaat
attgttcagtttgggaacacttcccttgcccttgcccgggaactggtaatggacaggtcc
aggctcgaagacgttattaagatcgccaaaaggatcactgccgaccacctcatgatggcg
accagcgaaaccttcaacaacttctatctctgcgaactctcctactggacccagggtatg
ccccttgaaatgtacaaccagatgctcgaaatgtacggcatccccgtcctccccgaaacc
ctggaacatgcctcaatcgaacgccgggtcagcaaagatatagaagaagtgggagcagaa
ggccttgccatcctcaaagaaatcggaatcaacctcgaagtccccgtgagcaagtgcatc
tactgccacaaatgcgaaaaagaatgccccgaaaacgccatcgaaataatcgaagacgct
gaaggcaagcggacagccagatacgacagccagaagtgcctgggaacaagttgccgccgc
tgcgtaaacatctgccccgaaggtgctatcgagatgtccaacctccagatcaaggaagca
aaataa

DBGET integrated database retrieval system