KEGG   Martelella endophytica: TM49_03705
Entry
TM49_03705        CDS       T03801                                 

Name
(GenBank) beta-lactamase
  KO
K18610  4-pyridoxolactonase [EC:3.1.1.27]
Organism
mey  Martelella endophytica
Pathway
mey00750  Vitamin B6 metabolism
mey01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mey00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TM49_03705
Enzymes [BR:mey01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.27  4-pyridoxolactonase
     TM49_03705
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2
Other DBs
NCBI-ProteinID: AJY44994
UniProt: A0A0D5LLD2
Position
complement(800956..801762)
AA seq 268 aa
MADTKVFLLDGGSLVLDGFHIWWNKGPGGEVRFPVYSVLVDHPKGKFLIDTGYDFDHVQK
VLPFEKPQQTKDQTIPGALKLLGLEPKDIDVLFNSHFHFDHVGGNKFFPDAKKICHKDEL
PQAAKCQPFEVLGYSDLAFSTDVAEARGMSDQLSAGQTAANTRFELIEGDVELAPGVTLI
YTPGHTIGHYSLLVEFDTRRPLLLTLDAAYTRKNYEQDINAGFHIDPVAGVNSMRRLKEI
EKAKDAEVLFSHDPESFKDYKTGVNFYG
NT seq 807 nt   +upstreamnt  +downstreamnt
atggctgacaccaaggtattcctgctcgatggcggttcgctggtgctcgacggtttccat
atctggtggaacaagggtccgggtggcgaggttcgctttcccgtctattccgtgctcgtt
gatcatccaaagggcaagttcctgatcgataccggctatgatttcgaccacgtgcagaag
gtgctgccgttcgaaaagccgcagcagaccaaggaccagacgatacccggcgcgctgaag
cttctggggctggagccaaaggacatcgacgtcctgttcaactcgcatttccatttcgac
catgtcggcggcaacaagttcttccccgacgccaagaagatctgccacaaggacgagttg
ccgcaggcggccaaatgccagcctttcgaagtgctcggctattccgacctcgccttctcc
accgatgtggcggaagcgcgcggcatgagcgatcagctcagcgccggccagacggcggcc
aacaccaggttcgaactgatcgagggcgatgtcgaactcgcgccgggcgtgacgctgatc
tacacgccgggccatacgatcgggcactattcgctgctggtggaattcgacacccgccgt
ccgctgcttctcacgcttgatgccgcctatacccgcaagaactacgagcaggacatcaat
gccggtttccacatcgatcccgtggccggcgtgaactcgatgcgccgcctgaaggagatc
gagaaggcgaaggacgccgaggtcctgttcagccacgatccggagagcttcaaggactac
aagaccggcgtcaatttctacggctga

DBGET integrated database retrieval system