KEGG   Alexandromys fortis (reed vole): 126507402
Entry
126507402         CDS       T08493                                 
Name
(RefSeq) calmodulin-like protein 4 isoform X1
  KO
K02183  calmodulin
Organism
mfot  Alexandromys fortis (reed vole)
Pathway
mfot04014  Ras signaling pathway
mfot04015  Rap1 signaling pathway
mfot04020  Calcium signaling pathway
mfot04022  cGMP-PKG signaling pathway
mfot04024  cAMP signaling pathway
mfot04070  Phosphatidylinositol signaling system
mfot04114  Oocyte meiosis
mfot04218  Cellular senescence
mfot04261  Adrenergic signaling in cardiomyocytes
mfot04270  Vascular smooth muscle contraction
mfot04371  Apelin signaling pathway
mfot04625  C-type lectin receptor signaling pathway
mfot04713  Circadian entrainment
mfot04720  Long-term potentiation
mfot04722  Neurotrophin signaling pathway
mfot04728  Dopaminergic synapse
mfot04740  Olfactory transduction
mfot04744  Phototransduction
mfot04750  Inflammatory mediator regulation of TRP channels
mfot04910  Insulin signaling pathway
mfot04912  GnRH signaling pathway
mfot04915  Estrogen signaling pathway
mfot04916  Melanogenesis
mfot04921  Oxytocin signaling pathway
mfot04922  Glucagon signaling pathway
mfot04924  Renin secretion
mfot04925  Aldosterone synthesis and secretion
mfot04970  Salivary secretion
mfot04971  Gastric acid secretion
mfot05010  Alzheimer disease
mfot05012  Parkinson disease
mfot05022  Pathways of neurodegeneration - multiple diseases
mfot05031  Amphetamine addiction
mfot05034  Alcoholism
mfot05133  Pertussis
mfot05152  Tuberculosis
mfot05163  Human cytomegalovirus infection
mfot05167  Kaposi sarcoma-associated herpesvirus infection
mfot05170  Human immunodeficiency virus 1 infection
mfot05200  Pathways in cancer
mfot05214  Glioma
mfot05417  Lipid and atherosclerosis
mfot05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mfot00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    126507402
   04015 Rap1 signaling pathway
    126507402
   04371 Apelin signaling pathway
    126507402
   04020 Calcium signaling pathway
    126507402
   04070 Phosphatidylinositol signaling system
    126507402
   04024 cAMP signaling pathway
    126507402
   04022 cGMP-PKG signaling pathway
    126507402
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    126507402
   04218 Cellular senescence
    126507402
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    126507402
  09152 Endocrine system
   04910 Insulin signaling pathway
    126507402
   04922 Glucagon signaling pathway
    126507402
   04912 GnRH signaling pathway
    126507402
   04915 Estrogen signaling pathway
    126507402
   04921 Oxytocin signaling pathway
    126507402
   04916 Melanogenesis
    126507402
   04924 Renin secretion
    126507402
   04925 Aldosterone synthesis and secretion
    126507402
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    126507402
   04270 Vascular smooth muscle contraction
    126507402
  09154 Digestive system
   04970 Salivary secretion
    126507402
   04971 Gastric acid secretion
    126507402
  09156 Nervous system
   04728 Dopaminergic synapse
    126507402
   04720 Long-term potentiation
    126507402
   04722 Neurotrophin signaling pathway
    126507402
  09157 Sensory system
   04744 Phototransduction
    126507402
   04740 Olfactory transduction
    126507402
   04750 Inflammatory mediator regulation of TRP channels
    126507402
  09159 Environmental adaptation
   04713 Circadian entrainment
    126507402
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    126507402
  09162 Cancer: specific types
   05214 Glioma
    126507402
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    126507402
   05163 Human cytomegalovirus infection
    126507402
   05167 Kaposi sarcoma-associated herpesvirus infection
    126507402
  09171 Infectious disease: bacterial
   05133 Pertussis
    126507402
   05152 Tuberculosis
    126507402
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    126507402
   05012 Parkinson disease
    126507402
   05022 Pathways of neurodegeneration - multiple diseases
    126507402
  09165 Substance dependence
   05031 Amphetamine addiction
    126507402
   05034 Alcoholism
    126507402
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    126507402
   05418 Fluid shear stress and atherosclerosis
    126507402
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mfot01009]
    126507402
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mfot04131]
    126507402
   03036 Chromosome and associated proteins [BR:mfot03036]
    126507402
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mfot04147]
    126507402
Protein phosphatases and associated proteins [BR:mfot01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     126507402
Membrane trafficking [BR:mfot04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    126507402
Chromosome and associated proteins [BR:mfot03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     126507402
Exosome [BR:mfot04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   126507402
SSDB
Motif
Pfam: EF-hand_7 EF-hand_9 EF-hand_6 EF-hand_1 EF-hand_8 AIF-1 EF-hand_11 FlgD
Other DBs
NCBI-GeneID: 126507402
NCBI-ProteinID: XP_050007709
Position
Unknown
AA seq 153 aa
MAKFLSQDQINEYKECFSLYDKQQRGKIKATDLLVSMRCLGASPTPGEVQRHLQTHGIDK
HGELDFSTFLTIMHTQIKQEDPRKEILLAMLMADKEKKGYIMASELRSKLMKLGEKLTHK
EVDDLFKEAGIEPNGQVKYDTFIQRITLPVQDY
NT seq 462 nt   +upstreamnt  +downstreamnt
atggccaagttcctttcccaggaccaaattaatgagtacaaagaatgcttctccctgtac
gacaagcagcagagagggaagattaaggccacagatcttctggtgtctatgagatgcctg
ggggccagccccacgcctggggaagtacagcggcacctgcagactcatgggatagacaag
cacggagagctggatttctccaccttcttgaccattatgcacacgcaaatcaaacaagag
gacccaaggaaagaaatccttcttgccatgctgatggctgacaaggagaagaaaggttac
atcatggcatctgaattgcgatcaaaactcatgaaactgggagagaagctcactcacaaa
gaagtggatgatcttttcaaggaagcgggcatcgaaccaaatggccaagtgaaatatgac
acatttatccagcggatcacccttcctgtgcaagactactga

  All links  
Gene (2)   
   NCBI-PROTEINID (1)   
   NCBI-Gene (1)   
Protein sequence (3)   
   RefSeq(pep) (3)   
DNA sequence (3)   
   RefSeq(nuc) (3)   
Protein domain (8)   
   Pfam (8)   
All databases (16)   

Download RDF
DBGET integrated database retrieval system