KEGG   Mycobacterium gallinarum: MGALJ_00530
Entry
MGALJ_00530       CDS       T07342                                 

Symbol
hcaB_1
Name
(GenBank) 3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase
  KO
K18257  cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase [EC:1.3.1.49]
Organism
mgau  Mycobacterium gallinarum
Pathway
mgau00624  Polycyclic aromatic hydrocarbon degradation
mgau01100  Metabolic pathways
mgau01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mgau00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    MGALJ_00530 (hcaB_1)
Enzymes [BR:mgau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.49  cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase
     MGALJ_00530 (hcaB_1)
SSDB
Motif
Pfam: adh_short adh_short_C2
Other DBs
NCBI-ProteinID: BBY90384
UniProt: A0A7I7UU84
Position
51324..52145
AA seq 273 aa
MTGGAAGIGLAVVERFLAEGACVGVLDRSEGDLATIGSADGRLIAVTGDVTAYDDNVRAV
RETVDAFGKLDVFVGNAGIFDYFAPLVGFDGADLSSAFDEIFAVNVKGYLLGARAAVPEL
LKSDGPSIIFTVSNSGFYASGGGPLYTASKHAVVGVVRELAYELAPKIRVNGVAPGGTIT
GLRGIEDLGQGGNVLSSVPGIADMMSVTNPLQYAQQPADHAGLYLLLASAENSRAVTGVV
INSDGGLGVRGLNQPSGGLELATGAMRNDVRSP
NT seq 822 nt   +upstreamnt  +downstreamnt
gtgaccggcggggcagccggaatcggtttggccgtggtcgagcggttcttggccgagggt
gcatgcgtgggtgtcttggatcgctcggaaggcgacctggctaccattggcagcgccgac
ggcaggctcatcgcggtaacaggtgacgttactgcgtatgacgacaatgtcagggcggtg
cgcgaaacggtcgatgcgttcggaaagctcgacgtgttcgtcggtaacgctgggatcttt
gactacttcgcccccttagtaggtttcgacggcgccgacctcagcagcgccttcgatgag
atcttcgcggtcaatgtcaaggggtacctccttggtgctagggccgccgttcctgaactc
ctcaaaagcgatgggcctagcatcattttcaccgtctccaactctggtttctatgcctct
ggtggcggcccgttatacaccgcttccaagcacgcagtcgttggcgtagtgcgtgaactg
gcgtacgagttggcgccgaagatccgggtgaatggcgtggctccaggcggcacgataacg
ggcctacgtggtatcgaagacctcggccagggcggaaacgtgttgtcatcggtgcccggc
atcgccgacatgatgagtgtcacgaaccctctgcagtacgcccagcagcctgccgatcat
gccggcctgtacttgctactcgcgtctgcagaaaactcgcgagcggtgacgggcgtcgtc
atcaacagtgacggcggcttgggcgtgcggggtctgaaccagccgtcgggagggctggaa
ctcgccaccggcgcgatgcgcaatgacgttcggtcgccttag

DBGET integrated database retrieval system