KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_0592
Entry
Mflv_0592         CDS       T00498                                 

Name
(GenBank) phthalate 3,4-dihydrodiol dehydrogenase
  KO
K18255  phthalate 3,4-cis-dihydrodiol dehydrogenase [EC:1.3.1.-]
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Pathway
mgi00624  Polycyclic aromatic hydrocarbon degradation
mgi01100  Metabolic pathways
mgi01120  Microbial metabolism in diverse environments
mgi01220  Degradation of aromatic compounds
Module
mgi_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mflv_0592
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-  
     Mflv_0592
SSDB
Motif
Pfam: adh_short adh_short_C2 TrkA_N Epimerase THF_DHG_CYH_C
Other DBs
NCBI-ProteinID: ABP43082
UniProt: A4T3E2
Position
complement(619395..620198)
AA seq 267 aa
MTGWLAGKRALIVGAGSGIGRATVDAFLNEDARVAVLEYDSGKCATLRQQLPDVPVIEGD
GTTRTANDEAVQVAVDAFGGLDTLVNCVGIFDFYRRIQDIPAERIDQAFDEMFRINVLSH
IHSVKAAVPALMGQDGASIVLTESASSFYPGRGGLLYVASKFAVRGVVTALAHELAPRIR
VNGVAPGGTLNTDLRGLDSLDLGARRLDAAPDRARELAARTPLGVALSGEDHAWSYVFLA
SHRSRGLTGETIHPDGGFSLGPPPQRN
NT seq 804 nt   +upstreamnt  +downstreamnt
atgactggctggctggcgggcaaacgcgcattaatcgtgggagcaggttcgggtatcggt
cgggccacggtcgacgcgttcctgaacgaggatgcccgggtggccgtgctcgagtacgac
agcggtaagtgcgccacgctgcgccagcagctgcccgacgttccggtgatcgagggtgat
gggaccactcgcaccgccaacgacgaagcagtgcaggtcgctgtcgacgccttcggcgga
ctcgacacattggtgaactgcgtggggattttcgatttctaccgccgtattcaggacatc
cccgccgagcgaatcgaccaggcgttcgacgaaatgtttcgcatcaacgtcctgagtcat
atccactcagtcaaggcagcagtgccggcgctgatgggccaggacggcgcctcgatcgtg
ctcaccgagtccgcgtcatcgttctatccaggacgcggcggcctgctgtatgtggcgtcg
aagttcgcggtgcgcggcgtagtcactgcactggctcacgaactcgcgccgaggatccgt
gtgaacggtgtcgcccccggggggacgttgaacaccgacctgcgcggactcgacagcctc
gaccttggcgcccgccgtctggatgctgcaccagatcgggcccgcgaattggctgctcgc
acaccgctgggcgtggccctatcgggtgaagaccacgcgtggagttacgtcttcctcgct
tctcaccgctcccgcgggctcaccggcgaaacgatccatcccgacggcggtttcagcctc
ggacccccaccccagcggaattga

DBGET integrated database retrieval system