KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_0621
Entry
Mflv_0621         CDS       T00498                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K18257  cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase [EC:1.3.1.49]
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Pathway
mgi00624  Polycyclic aromatic hydrocarbon degradation
mgi01100  Metabolic pathways
mgi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mflv_0621
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.49  cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase
     Mflv_0621
SSDB
Motif
Pfam: adh_short adh_short_C2
Other DBs
NCBI-ProteinID: ABP43110
UniProt: A4T3A9
Position
complement(642063..642968)
AA seq 301 aa
MGRCRATRALRITGGTIVLSWLTGQVALVTGGAAGIGLAVVERFLAEGACVGVLDRSEGD
LATIGNADGRLIAVTGDVTSYADNVMAVRETVDAFGKLDVFVGNAGIFDYFAPLVGFDGA
DLSSAFDEIFAVNVKGYLLGARAAVPELLKSDGPSMIFTVSNSGFYAAGGGPLYTASKHA
VVGVVRELAYELAPKIRVNGVAPGGTVTGLRGIEDLGQGQDVLSSVPGIADIMSTTNPLQ
YAQQPADHAGLYLLLASADNSRAVTGVVINSDGGLGVRGLNQPSGGTELATGAMRIDVGS
T
NT seq 906 nt   +upstreamnt  +downstreamnt
gtgggcagatgcagagcaacaagagcattgcgcatcaccggagggacgatagttttgagt
tggttgaccgggcaagtcgccctggtgaccggcggggcagccggaatcggtttggccgtg
gtcgagcgtttcttggccgagggcgcatgcgtgggcgtcctggatcgctcggaaggcgac
ctggctaccatcggcaacgccgacggcaggctcatcgcggtaacaggtgacgtgacgtcg
tatgcagacaacgtcatggcggtgcgcgaaacggtcgatgcgttcggaaagctcgacgtc
ttcgtcggcaacgctgggatcttcgattactttgcccctttggtgggtttcgacggagcc
gacctcagcagcgccttcgatgagatcttcgcggtcaatgtaaagggctacctccttggt
gccagggccgccgttcctgaactcctcaaaagcgatggcccgagcatgatcttcaccgtc
tccaactctggcttctatgccgccggtggcggcccgctgtacaccgcttccaagcacgcg
gtcgttggcgtagtgcgtgaactggcctacgagttggcgccgaagatcagggtgaatggc
gtcgctccaggtggcacggtaacgggcctgcgtggaatcgaggacctcggccagggtcag
gacgtgttgtcatcggtgcccggcatcgccgacattatgagtactacaaacccattgcag
tacgcgcagcagcccgccgatcacgccggcctgtatctgctactcgcgtctgcagacaac
tcgcgagcggtgaccggcgtcgtcatcaacagcgacggcggcttgggcgtgcggggcctc
aaccagccgtccggagggacggaacttgccaccggcgcgatgcgcatcgacgtcgggtca
acatag

DBGET integrated database retrieval system