KEGG   Methanohalophilus halophilus: BHR79_05305
Entry
BHR79_05305       CDS       T04572                                 

Name
(GenBank) methylamine utilization protein
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
mhaz  Methanohalophilus halophilus
Brite
KEGG Orthology (KO) [BR:mhaz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BHR79_05305
Enzymes [BR:mhaz01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     BHR79_05305
SSDB
Motif
Pfam: RACo_C_ter Raco_middle Fer4_21 Fer4_6 Fer4_7 Fer4 Fer4_9 Fer4_2 Fer4_10 Fer4_16 Fer4_17 Fer4_4 Fer4_3 Fer4_8 CMAS FGGY_N
Other DBs
NCBI-ProteinID: APH38964
UniProt: A0A1L3Q261
Position
1056237..1057862
AA seq 541 aa
MYGIALDLGTSGFRAQLIDLDTKDVLKTAITMRHPLPGGNVMDHLDFSIQVGPDISHEIM
MDTVKKIIERFDVDPADIRRIAICGNPIQLSIFQNIEIRDLAYAGKNKQKKLGVENVVRD
ARVFNASEIFEGVISLPNCEIIVPPAIKHEIGADALAMMIMTDFYEQEKPSLVTDYGTNA
EMALKIGNKIITGSAAAGPAIEGQGISCGMLASPGAISDVNPEGDYWRITILDKDMSPRK
AHLVEPITGDIKESSDMIAKGITGTGVIAAISVALDTGLIKKLPNLPNGKVILAEGVEIY
DRDIEEAGKAIGAIRAAHLTLLVEAGLAYEDLDYMYMSGATGAYIDANKARILGSCPNFS
KSIVQFGNTSISLARELVFDGGRLEEVKEVANRIKADHLMMAESNTFSNFYVCELSYWTQ
GMPIETYNQMLEMYGLPTLPEPYKDPVIEKRVIKDIDEVGKEGLEVVSDLGIVIEEEAPK
CILCRKCEEECPEDAIVALEKDGKRYVHYDSEKCLGTACHRCVTICPVDAIHYIDIDIKT
L
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgtatggtattgctctagatttgggaacaagtggttttcgggcacaattgattgatctt
gatacgaaggatgttttaaagactgctattacaatgcgccaccctttgccgggtggcaac
gtgatggatcatctggatttttctattcaggtaggtccggatatttcacatgaaataatg
atggatacggtaaagaaaataatcgaaagattcgatgttgatccggcagatatccggcgt
attgctatatgcggaaaccctatacagctttcaattttccagaacattgagatccgcgat
cttgcttatgcaggtaaaaacaaacaaaagaagcttggtgtcgaaaatgtggtgcgggat
gctcgggttttcaatgcttctgagatatttgagggtgtgatctctcttccaaattgtgaa
attattgtccctcctgcaatcaaacatgagattggtgcagatgcattggcaatgatgatt
atgactgatttctatgagcaggaaaaaccttctcttgtaacggattatggtacaaatgcc
gaaatggcactgaaaatagggaacaagattattactggcagtgcagctgcgggtcctgca
attgagggtcagggtatttcctgtggtatgcttgcaagtcccggtgcaatatccgatgta
aatcctgaaggtgattattggagaatcactattctggataaggatatgtctccccgtaaa
gcccatctggttgagccgattaccggtgatataaaagaatccagtgacatgattgcaaaa
gggattaccggtacaggagtaattgcggcgatttcggttgccctggatactggattaata
aagaagcttccaaatctgcccaacggtaaagttattctggctgaaggtgtggaaatttat
gaccgggatatcgaagaagcaggcaaagcgattggtgcgatacgtgctgcacacctgact
ttacttgttgaagcaggtcttgcatatgaagaccttgattatatgtatatgtccggcgca
acaggtgcatatattgatgcgaacaaggccagaatactggggtcctgcccaaacttctcc
aaatcaatcgtgcaatttggtaacacttcgatctcccttgcaagggagcttgtgtttgat
ggaggtcgtcttgaggaagtaaaggaagtagccaacagaataaaggctgaccatttgatg
atggccgaaagcaatactttttcgaacttctatgtttgtgaactttcctactggacacag
ggaatgcccattgaaacatacaatcagatgcttgaaatgtatggtcttccaacattaccc
gagccttataaggatcctgtaattgaaaaaagggtaataaaggatatcgatgaagtaggc
aaagaaggccttgaagttgtgagcgatctgggtatcgtaatagaagaggaggctcccaag
tgtatcctttgccgtaagtgtgaggaggaatgtccagaagatgctattgtggcactggaa
aaggacggtaaaagatacgtgcattatgatagtgaaaaatgccttggaactgcctgtcat
cgttgcgtgacaatttgtccggtggacgcaattcattacatagacattgatatcaaaaca
ctctga

DBGET integrated database retrieval system