KEGG   Mycolicibacterium helvum: MHEL_18740
Entry
MHEL_18740        CDS       T07064                                 

Name
(GenBank) hypothetical protein
  KO
K22355  alkene monooxygenase coupling protein
Organism
mhev  Mycolicibacterium helvum
Pathway
mhev00625  Chloroalkane and chloroalkene degradation
mhev01100  Metabolic pathways
mhev01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mhev00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MHEL_18740
SSDB
Motif
Pfam: MmoB_DmpM
Other DBs
NCBI-ProteinID: BBY63631
UniProt: A0A7I7T545
Position
2019279..2019629
AA seq 116 aa
MARAIARPAERGVGVSLIHSFETDAIARHLRRTQPHVTLTDRGVYLKADAADEITIDLAA
LSADLGRPIDIETVLISIASYFGEIEPQRGAAPGTGRLILRADAPPEETADQKAIS
NT seq 351 nt   +upstreamnt  +downstreamnt
atggcccgcgctattgcccgtcctgccgagcgtggcgtcggcgtcagtctcatccatagt
ttcgaaaccgacgccatcgcgcgtcacctgcggcgcacccaaccacacgtcacgttgacc
gaccgcggcgtttatctcaaagccgatgccgccgacgagatcacgatcgatctcgccgcg
ctgtctgctgacctgggccgccccatcgacatagaaacggtattgatttccatagcgagc
tatttcggtgaaatcgaaccccagcgcggggccgcgcccggcaccggtcgactcatcctg
cgcgccgatgcacctcccgaagaaaccgctgaccagaaagccatctcatga

DBGET integrated database retrieval system