KEGG   Mycolicibacter hiberniae: MHIB_39870
Entry
MHIB_39870        CDS       T06801                                 

Name
(GenBank) hypothetical protein
  KO
K22355  alkene monooxygenase coupling protein
Organism
mhib  Mycolicibacter hiberniae
Pathway
mhib00625  Chloroalkane and chloroalkene degradation
mhib01100  Metabolic pathways
mhib01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mhib00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MHIB_39870
SSDB
Motif
Pfam: MmoB_DmpM AbiEi_1
Other DBs
NCBI-ProteinID: BBZ25569
UniProt: A0A7I7X6W8
Position
4250529..4250879
AA seq 116 aa
MARTTAQPAARGVGASLIKGPETDAIARYLRRTQPTVNVTDRGVYLKADAPDEIIIDLAE
VSAEFGRPLEIEDVLIVLASYFGEIDPQRGARPGAGRLVLRADSLSDRSQEDEGIR
NT seq 351 nt   +upstreamnt  +downstreamnt
atggcgcgcacaacggcacagccggccgcgcgtggcgtgggcgccagcctcatcaaggga
ccggaaaccgacgccatcgcccggtacctgcggcgcacccaaccgacggtcaacgtcacc
gatcggggtgtgtacctcaaagcagacgctcccgacgagatcatcatcgatctcgccgag
gtgtctgccgagttcgggcgaccgctcgaaatcgaagacgtcttaatcgttttagcaagc
tatttcggagagatcgacccacagcgtggagcgcgtcccggcgccggccgactggtgttg
cgcgcagactccctgagcgatcgctcccaggaagacgaaggtatccgatga

DBGET integrated database retrieval system