KEGG   Methanosarcina horonobensis: MSHOH_3970
Entry
MSHOH_3970        CDS       T03933                                 

Name
(GenBank) NADH dehydrogenase subunit I
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
mhor  Methanosarcina horonobensis
Brite
KEGG Orthology (KO) [BR:mhor00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MSHOH_3970
Enzymes [BR:mhor01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     MSHOH_3970
SSDB
Motif
Pfam: RACo_C_ter Raco_middle Fer4 Fer4_21 Fer4_6 Fer4_7 Fer4_9 Fer4_16 Fer4_2 Fer4_10 Fer4_17 Fer4_3 Fer4_4 Fer4_8
Other DBs
NCBI-ProteinID: AKB80453
UniProt: A0A0E3SJL0
Position
complement(4859172..4860794)
AA seq 540 aa
MYGIALDLGTSGFRAQLIDLETNETLKTVITMGHPLPGGNVMDHLDFAITTGEDVAHGVI
IETIRRMFLKFDADLSKVERLAVCGNPIQLSLFQNIEIRDLAYAGENKQKMLGVQNVKRD
ARVFPASELFGDYLPNCEIIVPPAIKHEIGADALAMMLETDFLVQTEPALVTDYGTNAEM
ALKVGDRIITASAAAGPAIEGQGISSGMLASPGAICDVKSAGEYWRIMVLDREMEKQDAY
FINPVTGEMKEVNGCEAAGITGTGVISAFALALRSGLIEKPPKLPNGKLILGPGIEITET
DVEEAGKAIGAIRAAHLTLIVESGIKYEQLEYAYMSGASGAYVDAEDARRLGAAPGYAKK
VVQFGNTSLALARELVLNRSRLNDVIEVAKKITADHLMMATSETFNNFYLCELSYWTQGM
PLEMYDQMLDLYGLPRLPKTLEHADIEKRVSKDIEKVGPGGLAILKEIGIILEVPVEKCI
YCQKCVEECPEDALEIIETDDGRRVAKYDSQKCLGTSCRRCVSVCPEDAIDVTKLKIKAK
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgtacggaattgcacttgacctgggtaccagcggttttagagcccagcttatcgacctt
gaaacaaacgaaaccttaaaaacagtaataaccatgggccaccccctgccaggaggaaat
gttatggaccacctggactttgcaataacgacaggagaggatgtggctcacggcgtaatt
atcgagaccatcaggaggatgttccttaaattcgatgcagacctttcgaaagtagaaagg
cttgcagtctgcggaaaccctatccagctttctcttttccagaatatcgaaataagggac
ctcgcatatgccggggaaaacaagcagaaaatgctcggggtccagaacgtaaaaagagat
gctcgtgtatttccagcctcagagcttttcggggactaccttcctaactgtgaaataatc
gtacctccggcaatcaaacacgagatcggggctgatgcccttgccatgatgctcgaaacc
gatttccttgtccagacagaacctgctcttgtgaccgattacgggacaaatgcagaaatg
gctctcaaagtcggtgaccggataataacggcaagtgctgctgcaggtcctgctatcgaa
gggcagggcataagttcgggtatgcttgcaagcccaggggcaatctgtgatgtaaagtct
gcgggcgaatactggagaattatggtgctcgatagggagatggaaaagcaggacgcttac
tttattaaccctgtaaccggcgaaatgaaagaagtaaacgggtgtgaggctgcaggcatt
acagggacaggagtaatttcggcttttgcccttgctctgagaagtgggttgattgaaaag
cctccaaaactcccaaatggaaaactgattctgggccccggaattgaaattactgagaca
gatgtcgaagaagcaggaaaagcgataggtgcgattcgtgctgctcacctgactctcata
gtggaatccgggattaaatacgaacaacttgaatacgcatacatgtcgggagcctcagga
gcttatgtggacgctgaagacgcccgcaggctcggcgccgctccgggttatgcaaaaaaa
gtagttcagttcggaaacacctcccttgcccttgcacgggaacttgtactgaacagatcc
aggctgaatgatgtaatcgaggttgcaaaaaagattactgccgaccacctgatgatggca
accagtgagacttttaacaacttctacctctgcgaactttcctactggacccagggtatg
ccgctcgaaatgtatgaccagatgcttgacctctatggtctgcccagacttccgaaaact
ctcgaacacgctgacatagaaaaacgggtcagcaaggacatagagaaagtaggacccgga
gggcttgccatcctgaaagaaataggcataatccttgaagtccctgtggagaaatgcatc
tactgccagaagtgtgtagaagaatgtcctgaagatgctctcgaaattatcgaaactgat
gatggtagaagggtcgcaaaatacgacagccagaaatgcctgggtacaagctgccgccgg
tgtgttagcgtctgccctgaagatgcaattgatgttacaaaactcaaaatcaaagcaaaa
taa

DBGET integrated database retrieval system