KEGG   Methanospirillum hungatei: Mhun_2095
Entry
Mhun_2095         CDS       T00325                                 
Name
(GenBank) membrane-bound hydrogenase subunit ehaC
  KO
K14094  energy-converting hydrogenase A subunit C
Organism
mhu  Methanospirillum hungatei
Brite
KEGG Orthology (KO) [BR:mhu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    Mhun_2095
SSDB
Motif
Pfam: DUF2109
Other DBs
NCBI-ProteinID: ABD41802
UniProt: Q2FMA8
Position
2373456..2373782
AA seq 108 aa
MSIDGTEDLLGLISGPFSSSYISPPSESAELAALMCGLIALYAVIRIILEQDVMRKLPFL
NVFSFAVSGIMALLIPHPLGIIAAATYFIGSTFESNAIASTWAGGVEE
NT seq 327 nt   +upstreamnt  +downstreamnt
atgagcatcgacggaacagaagacctgcttggcttgatatccggcccattctcctcctca
tatatcagccccccgtctgagagtgctgaacttgcagccctcatgtgtggccttattgct
ctctatgcagtcatcagaatcattcttgaacaggatgtcatgcgtaaactgccattcctg
aatgtattcagctttgctgtttccggaatcatggcccttctcatccctcacccgcttggg
attattgccgcagcaacctattttatcggctcgacatttgaatcaaatgctatcgcgagc
acgtgggccggaggggtggaggaatga

DBGET integrated database retrieval system