KEGG   Mesorhizobium huakuii: MCHK_0424
Entry
MCHK_0424         CDS       T06432                                 

Name
(GenBank) MBL fold metallo-hydrolase
  KO
K18610  4-pyridoxolactonase [EC:3.1.1.27]
Organism
mhua  Mesorhizobium huakuii
Pathway
mhua00750  Vitamin B6 metabolism
mhua01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mhua00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MCHK_0424
Enzymes [BR:mhua01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.27  4-pyridoxolactonase
     MCHK_0424
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2
Other DBs
NCBI-ProteinID: AID28257
UniProt: A0A068D5F4
Position
complement(5964295..5965101)
AA seq 268 aa
MSDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMK
VLPFEKPIQEKHQTIPGALALLGLEPKDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEV
PQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLARGVKLI
STPGHSIGHYSLLVEFPKRKPIMFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKL
AEDHGAELMYSHDMENFKTYRTGTQFYG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtcggataccaaagtctacctgctcgacggcggctcgctcgttctcgacggctaccac
gtgttctggaaccgaggccctggcggcgaagtgcgcttccccgtctattcgatcctgatc
gagcatgccgagggccggttcctgatcgacaccggctacgactacgatcacgtcatgaag
gtgctgcccttcgagaagccgatccaggaaaagcaccagaccatccccggcgcgcttgcg
ctgctcggcctcgagccgaaggacatcgacgtcgtcgtcaactcgcatttccatttcgac
cattgcggcggcaacaagtattttccgcatgccaagaagatctgccatcgctcggaggtg
ccgcaggcctgcaatccgcagcctttcgaacatctcggctattcggacctgagcttctcg
gcggaggccgccgaagcgcgaggcgcgacggcgcagctgctggaaggcacgacgcgcgcc
aactcgaccttcgagggcatcgacggcgacgtcgatctcgccaggggcgtcaagctgatc
tcgacgcccggccattcgatcggccactacagcctgctggtcgagttccccaagcgcaag
ccgatcatgttcaccatcgacgccgcctacacccagaagagcctggagacgctgtgccag
gctgccttccacatcgacccggtggcaggcgtcaattcgatgcgcaaggtgaagaagctc
gccgaggaccatggcgccgagctgatgtactcgcacgacatggaaaacttcaagacctac
aggaccggcacgcaattctacggctga

DBGET integrated database retrieval system