KEGG   Methanomethylovorans hollandica: Metho_0004
Entry
Metho_0004        CDS       T02418                                 

Name
(GenBank) putative metal-binding protein
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
mhz  Methanomethylovorans hollandica
Brite
KEGG Orthology (KO) [BR:mhz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Metho_0004
Enzymes [BR:mhz01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     Metho_0004
SSDB
Motif
Pfam: RACo_C_ter Raco_middle Fer4_6 Fer4_21 Fer4_9 Fer4_7 Fer4_10 Fer4 Fer4_8 Fer4_2 Fer4_17
Other DBs
NCBI-ProteinID: AGB48302
UniProt: L0KSC3
Position
4420..6063
AA seq 547 aa
MLFEGIFMYVIALDLGTSGFRSQLIDIETRETIKTVITMGHPLPGGNVMDHLDFAISTGK
DVAHGLIIEAVKKVLERFNVDPLSIQRIAVCGNPIQLSLFQNSEILDLAYAGEAKQKKLG
VHDVKRDARIFPANQIFKGIYEMDNCEIVVPPAIKHEIGADALAMMMETDFINQNEPCLV
TDYGTNAEMALKVGERIITASAAAGPAIEGQGINCGMLAGPGAISDVNLEGSYWRLIVLN
EEMEPIESDLVDPVSGEIIESSGIKAKGITGTGVISTIALAIKEGLTKKLPHLPEGRIVL
GDGIIITDKDVEEVGKAIGAIWAAHMTLMIEAGIEYSDLKYVYMSGATGTYVDAEKARHL
GSVPGFIPNIVQFGNTSIGLARKLAVDPIKLCDVISVAKKIHADHLMMATSETFKDIYLC
ELSYWQQGMPLEIYDQMLQLYKIKPFPQNLEKVNIERRVSKDIDDVGEKGIEIVKDIGII
LEAPVVKCIMCHKCEKDCPEDAVIIIEREGKRFANIDSQHCLGTSCRRCVTICPEQTMNH
SILKVKR
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgctttttgaaggtatcttcatgtatgtaattgcactagaccttggtactagcggtttc
agatcgcagctgatagatatagagacaagagaaactattaaaactgtgatcactatgggt
catccactccctggcgggaatgtaatggaccatctggattttgcgatcagcacaggcaag
gatgtagctcatggattgataattgaggctgtgaagaaagtactggaaagattcaatgtt
gatccattaagtatacagagaatagctgtttgtggtaatcctatacagttatcccttttt
cagaatagtgagattctggaccttgcgtatgcaggcgaggccaagcagaaaaaactgggt
gttcacgatgtgaaaagagatgctcggatcttccctgccaaccagatattcaaaggcatc
tatgagatggacaactgtgagatagtagtccctcctgcaataaaacatgagataggtgct
gatgcccttgccatgatgatggaaaccgatttcataaaccagaatgaaccgtgtttggta
acagattatggaacaaatgcagagatggcattaaaagtaggagagaggatcatcactgca
agcgctgcagctggtccggccattgaaggtcagggcatcaattgcggtatgctggcaggt
cccggagccataagtgatgttaatcttgagggttcctactggcggctcatagtgctcaac
gaggagatggaacccatagaaagtgatcttgtagatccagtttccggtgaaatcattgaa
tcttctggaataaaggccaaaggtattacaggaacaggggttatttctaccattgctttg
gctatcaaggaaggcctgacgaaaaagttgccgcatcttccagagggaaggattgttttg
ggtgatgggatcataatcaccgataaggatgtggaagaagtgggtaaggcgatcggtgcc
atctgggctgctcacatgactctcatgatagaagccggtattgaatactctgacttgaaa
tacgtttatatgtcgggggctacgggcacatacgttgatgctgaaaaggcgagacattta
ggttctgtaccgggttttatccctaatattgtccagtttggcaacacttccatcggtctt
gcaagaaagcttgctgtggatcctataaagttgtgtgatgtcatatctgtagcaaagaaa
atacatgccgatcatctcatgatggctacaagtgaaacatttaaagacatatatctctgt
gaactgtcttactggcaacagggaatgcctttggagatctatgatcagatgcttcagtta
tataaaattaaacctttcccccaaaaccttgaaaaggtgaatatagaaagacgtgtttca
aaggatattgatgatgtgggggaaaaaggcatagagattgtaaaggatataggtatcatc
cttgaggcacctgtggtaaaatgtataatgtgccataaatgtgaaaaagactgtcctgaa
gatgctgtaattatcattgaaagagaaggtaagaggtttgcaaatatagacagccagcat
tgccttggtacaagttgtagacgttgtgttaccatctgtcccgaacaaacaatgaaccat
tcaattttgaaggtgaagcgttaa

DBGET integrated database retrieval system