KEGG   Methanotorris igneus: Metig_1611
Entry
Metig_1611        CDS       T01510                                 
Name
(GenBank) Protein of unknown function DUF2109, membrane
  KO
K14094  energy-converting hydrogenase A subunit C
Organism
mig  Methanotorris igneus
Brite
KEGG Orthology (KO) [BR:mig00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    Metig_1611
SSDB
Motif
Pfam: DUF2109 CarS-like DUF4131 Imp-YgjV DUF5508 SPC12
Other DBs
NCBI-ProteinID: AEF97144
UniProt: F6BBD7
Position
1656587..1656832
AA seq 81 aa
MDLSSIIIGVIAVICGLRVFLTQSRARKLLYLCCLNFCIAALIALYIKSPMGSLAAIVYL
ISSTLSSNAIAYTLEQMKKME
NT seq 246 nt   +upstreamnt  +downstreamnt
atggatttatcatcaataataattggagttattgcagttatttgtgggttgagggttttc
ttaactcaaagtagggcgagaaagttgttgtatctctgctgtttaaatttctgcattgcg
gcattgatagcattgtatataaaaagtcctatgggtagtttggcagctattgtttattta
atctcgtccacactctcaagtaacgctatagcatacacattagagcagatgaaaaaaatg
gaataa

DBGET integrated database retrieval system