KEGG   Micromonospora sp. L5: ML5_4422
Entry
ML5_4422          CDS       T01379                                 

Definition
(GenBank) protein of unknown function DUF1486
  KO
K15943  nogalonic acid methyl ester cyclase / aklanonic acid methyl ester cyclase [EC:5.5.1.26 5.5.1.23]
Organism
mil  Micromonospora sp. L5
Pathway
mil01057  Biosynthesis of type II polyketide products
mil01100  Metabolic pathways
mil01110  Biosynthesis of secondary metabolites
Module
mil_M00781  Nogalavinone/aklavinone biosynthesis, deoxynogalonate/deoxyaklanonate => nogalavinone/aklavinone
Brite
KEGG Orthology (KO) [BR:mil00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    ML5_4422
Enzymes [BR:mil01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.23  aklanonic acid methyl ester cyclase
     ML5_4422
    5.5.1.26  nogalonic acid methyl ester cyclase
     ML5_4422
SSDB
Motif
Pfam: SnoaL SnoaL_2 PHZA_PHZB
Other DBs
NCBI-ProteinID: ADU09899
Position
4699834..4700268
AA seq 144 aa
MSSQTDAVRRVINAFNTGKTDDVDEYIHDEYLNPATLEHGISQGPKAFAMVVAWVRRTFS
EEAHLEEINVTENGEWVRAHLVLYGRHVGNLVGIPPTGRRFAGEQIHLFRIVDGKIRDHR
DWPDFQGTLRQLGDPWPENGGWRP
NT seq 435 nt   +upstreamnt  +downstreamnt
atgagcagtcagaccgacgccgtacggcgcgtgatcaacgcgttcaacaccggcaagacc
gacgacgtcgacgagtacatccacgacgagtacctcaacccggcgacgctcgaacacggc
atctcgcagggtccgaaggccttcgcgatggtcgtcgcctgggtacgccggacgttctcc
gaggaggcgcacctcgaagagatcaacgttaccgagaacggcgaatgggtccgcgcccac
cttgtgctgtacggccgtcacgtcggcaacctcgtcgggatcccgccgaccggccggcgc
ttcgccggcgagcagatccacctcttccggatcgtcgacggcaagatccgcgaccaccgc
gactggcccgacttccagggcaccctgcgccagctcggtgacccgtggccggagaacggc
gggtggcggccgtga

DBGET integrated database retrieval system