KEGG   Macadamia integrifolia (macadamia nut): 122062797
Entry
122062797         CDS       T07436                                 
Name
(RefSeq) coumarin 8-geranyltransferase 1, chloroplastic-like
  KO
K21587  coumarin 8-geranyltransferase [EC:2.5.1.138]
Organism
ming  Macadamia integrifolia (macadamia nut)
Brite
KEGG Orthology (KO) [BR:ming00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    122062797
Enzymes [BR:ming01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.138  coumarin 8-geranyltransferase
     122062797
SSDB
Motif
Pfam: UbiA
Other DBs
NCBI-GeneID: 122062797
NCBI-ProteinID: XP_042482373
Position
Unknown
AA seq 398 aa
MLGVAASSSSLQAHPSHERGWLSREPKSLKASFVVPFQGQVNCEKNIKKKWHSTQRFQCC
SQRSSALGNNEGNVEIQSSKQDRLENDYSSKQEDAYNGPLGKIYALYRFTRPYAAMGTGL
SVASVSCLPIETIADFTPTFFVGVLKAIIPTVLAHIYSAGVNQVYDIEIDKANKKNLPIA
SEVFSIETAKTIVWIVTLLSLSMGVMSQSLALLCGILSCFMYGTIYSVDLPFLRWKRDPI
LAAAIIGFWKGIGSIIPYFIHAQNYILGRPIIITKSLIFASVVMSLHVFLLLVSVSNISP
PCECFEPSFLPQTSSFAFPLLYNGFIVQPTTAKPNDHEEEDDPLEVDDIYIRAALVNWEN
TFVGYIIPGKAHRCQAVSEGLIAAWNLGFWLTFLSYTE
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgttaggggtcgccgcttcatcttcttctctccaagcacacccatctcatgaaagaggt
tggttgtcgagggagcctaaatccttgaaagcgagttttgttgtaccgtttcaagggcaa
gtgaattgtgaaaagaatatcaagaaaaaatggcattctacccaacgctttcaatgttgt
tcccaaagatcctctgctttaggtaataacgaaggaaacgtagagattcaatcttccaag
caagacaggttagagaatgattattcatccaaacaagaggatgcttataatggaccattg
ggaaaaatatacgcattgtacagatttactcgtccatatgctgccatgggcacaggtcta
tctgtagcatctgtttcttgtcttcccatagaaacaattgctgatttcactccaacattt
ttcgtaggagtactaaaggctattatccctacagtattggctcacatttattcagctgga
gtgaatcaagtttatgatatagaaattgacaaggctaacaaaaaaaatcttccaatcgcc
tctgaagtcttctcaatcgaaactgctaagaccattgtttggatagtcacattgctgagc
ctttctatgggagtcatgtcccaatccttggcacttctctgcggcattctttcttgcttt
atgtatggaactatatattctgttgatcttcccttccttaggtggaaaagagatcctata
ctcgctgcagcaatcattgggttctggaagggtattggtagcattattccctactttata
catgctcagaattatatactggggaggccaataattattaccaagtcattgatatttgct
tcagttgtaatgtctctacatgtatttctcctccttgtgagtgtttcaaacatttctcct
ccttgtgagtgctttgaaccttcttttctacctcaaacctcttcgtttgcctttcctctc
ttgtacaatggcttcatcgtccaacccaccaccgccaaacccaatgatcatgaagaagaa
gacgatccgctagaagtggatgatatttacataagagctgcgctggtcaactgggaaaac
acttttgtaggatacatcattcccggcaaggcccacaggtgtcaagcagtctcagaaggt
cttatagctgcgtggaacctaggtttttggttgacgtttctctcctacacggaataa

DBGET integrated database retrieval system