KEGG   Macadamia integrifolia (macadamia nut): 122064065
Entry
122064065         CDS       T07436                                 
Name
(RefSeq) homogentisate geranylgeranyltransferase-like isoform X1
  KO
K21587  coumarin 8-geranyltransferase [EC:2.5.1.138]
Organism
ming  Macadamia integrifolia (macadamia nut)
Brite
KEGG Orthology (KO) [BR:ming00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    122064065
Enzymes [BR:ming01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.138  coumarin 8-geranyltransferase
     122064065
SSDB
Motif
Pfam: UbiA DUF441 DUF485
Other DBs
NCBI-GeneID: 122064065
NCBI-ProteinID: XP_042483695
Position
Unknown
AA seq 394 aa
MEALLKPACSTFPLRKYSTHERGYLRTDSPCITSRKMPVSYLNDVHRKWNIKQKFQLSAL
ENHNQGYVEKLSHDKYMLENELSSSKHEDGYSILLKKLNAFYHFCRPYNLVGIVIGIFSV
SVLPIQSIADLSPTYFMGLVQTLALGTLTHIYVMAMNQLFDIEIDKVNKQYLPLASGEFS
SRDIVVIALLVTILSIGVVFMSKSPALLCALVVGYLYGTAYSAEIPFLRWKRRPLLAITS
TVLTFVLGIQIPYFIHIQKYVLGRPNLITKSLIFQTTVMCLHCISGMIFKDIPDTDGDRD
NGIETLSIRFGRERAFAIGLNILFAQFGLAMVLGASSSLWFGKPITVFGHLTLALVVWNR
SRHTDPTDNSSAQSFHMFFWKLASIEFLLTQFVR
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggaagcacttcttaaaccagcctgctcaacttttcctctccgaaagtactccactcat
gaaagaggttacctgagaacggattctccatgcatcactagtagaaaaatgcctgtgagt
tatctaaatgatgtccatagaaaatggaatatcaagcaaaagtttcagctttcagcatta
gaaaaccacaatcaaggatacgttgaaaagctatcccatgacaaatatatgttagagaat
gagctttcatcatcaaaacatgaggatggttattctatccttttgaagaaattaaatgca
ttctatcacttttgccggccatataacttggtgggaattgtcattggaatattctcagtt
tcagttctcccaatacaatcaattgctgatctttctccaacatattttatgggattggta
cagacattggcactgggaacattaactcacatctatgtgatggcaatgaatcagttgttt
gatatcgaaattgacaaggtgaataagcaatatcttccgctagcttctggagagttttca
agtagagatattgtggtgatagctttgttggttaccatcctgagcattggtgtggtattt
atgtctaaatctccagcacttctatgtgccctggttgtaggctatctatatggaactgca
tattctgctgaaattcccttccttaggtggaaaagacgtcctttacttgctataacaagc
acagtgctcacttttgttcttggtattcaaatcccttattttatacacattcagaaatat
gtacttgggagaccaaacctcattacaaaatcattgatatttcaaacaacagtgatgtgt
ttgcactgcatttctggaatgatatttaaggacattccagatacggatggagatagagat
aatggcattgaaactctgagcattcgatttggcagagaaagagcatttgctattggtctc
aatatcctatttgcacaatttggacttgccatggtactaggagcatcatcatcactttgg
tttggcaagcctataacagtatttggtcaccttacacttgctttagttgtttggaaccgt
tctcgacacacagaccccaccgacaactcatcagcgcagtcttttcatatgttcttttgg
aagttagcttctattgagttcctcctcacccaatttgtacgttga

DBGET integrated database retrieval system