KEGG   Macadamia integrifolia (macadamia nut): 122066900
Entry
122066900         CDS       T07436                                 
Name
(RefSeq) coumarin 8-geranyltransferase 1b, chloroplastic-like
  KO
K21587  coumarin 8-geranyltransferase [EC:2.5.1.138]
Organism
ming  Macadamia integrifolia (macadamia nut)
Brite
KEGG Orthology (KO) [BR:ming00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    122066900
Enzymes [BR:ming01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.138  coumarin 8-geranyltransferase
     122066900
SSDB
Motif
Pfam: UbiA
Other DBs
NCBI-GeneID: 122066900
NCBI-ProteinID: XP_042486663
Position
Unknown
AA seq 360 aa
MSVGYLHDIGRKCNVKQSSKLSALADNQGGHIEKLPNEKYALENNELSLKHGDDGGYASL
LHKLETFYHFCRPYALMGMDIGILSISLLPIQSVADLSPRFFMGLLQALALGPLTHIYIV
AVNQLYDVKIDEVNKQYLPLASGEFSTRDVHAICLIVTILSIGIVYVSKSPALLWGLVAN
YLFGTAYSAQLPFLRWKRHPLLAMSTMVLWCALGIQIPYFIHIQKYVLGRPNPITKSLIF
QTIVLCTYGISGTILKDIPDTDGDRENGIDTLSIRFGRERAFAIGVNVLYAQFGLAMALG
ASSSLWFAKLISVLGHLALALVVWYRSRHTDPTNKSSAQSFYMFFWKLVCVEYLLLQFVR
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctgtaggttatctacatgatattggtaggaaatgtaatgtcaagcaaagctctaaa
ctgtcagcattagctgacaatcaaggaggacacattgagaagcttcccaatgaaaaatat
gcgttagagaataatgagctttcattgaaacatggcgatgatggtggttatgctagcctt
ttgcataaattagaaacattctatcacttttgccggccgtatgccttgatgggaatggat
attgggatattatcaatttcactcctgcctatacaatcagttgctgatctttctccaaga
ttttttatgggattgctacaggcattggcacttggaccattgactcacatctatattgtc
gcagtgaatcaactgtatgatgtcaaaatcgatgaggttaataagcaatatcttccttta
gcttctggagagttttcaactagagatgtccatgccatctgtttgattgtaaccattctg
agcattggcattgtatatgtgtctaaatctccagcacttctttggggcctagttgctaac
tatctatttggaactgcatattctgcccaacttcccttccttagatggaaaagacatcct
ttacttgctatgtcaaccatggtgctctggtgtgctctcggcattcaaatcccctatttc
atacacatccagaaatatgtacttggaagaccaaaccctattacaaagtcgttgatattt
caaacaatagtgttgtgtacgtatggcatttctggaacgatattaaaggacatcccagac
acggatggagatagagaaaatggcattgacaccctcagcattcgatttggcagagaaaga
gcattcgctattggtgttaatgtcctatatgcacagtttggtcttgccatggcactagga
gcttcatcatcactttggtttgccaagcttatatcagtactgggtcaccttgcacttgct
ttagttgtttggtatcgttctcgacacactgaccccacaaataaatcatcagcacagtcc
ttttatatgttcttttggaagctagtgtgtgttgagtacctccttctccagtttgttcgt
tga

DBGET integrated database retrieval system