Mixta intestinalis: C7M51_00035 Help Entry C7M51_00035       CDS       T06391                                  Symbol mutT Name (GenBank) 8-oxo-dGTP diphosphatase   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism mint  Mixta intestinalis Brite KEGG Orthology (KO) [BR:mint00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:mint03400]     C7M51_00035 (mutT) Enzymes [BR:mint01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      C7M51_00035 (mutT) DNA repair and recombination proteins [BR:mint03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     C7M51_00035 (mutT)  Prokaryotic type     C7M51_00035 (mutT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX_4 NUDIX Nudt16-like Motif Other DBs NCBI-ProteinID:  QHM69782 UniProt:  A0A6P1PUP4 Position 42862..43260 Genome browser AA seq 132 aa AA seqDB search MKHLQVAVGIIRNARQEIFLTRRPASSHMANMWEFPGGKIEAGETPEQALRRELLEETGI VVMAATAFDHADHTYHDVRVTLHFFLVEQWQGEPWGREGQPQRWVPQRELIADEFPPANH QLVARLLAETRP NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgaaacatcttcaggttgccgttggcattatccgtaacgcccggcaggaaatctttctg acgcgccgtccggccagttcacatatggcaaatatgtgggaatttcccggcgggaaaatt gaagcgggagaaacgccagagcaggcgctgaggcgtgaattgctggaggaaaccggtatc gtggtaatggcggctaccgcattcgatcatgccgatcacacttaccatgacgtgcgcgtt acgttgcacttttttcttgtggaacagtggcagggtgaaccctggggacgggaagggcag ccgcagcgctgggtgccacagcgcgaactgatcgccgatgagtttccaccggcgaatcat cagctggttgctcgtctgctggccgaaacgcgtccgtaa

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (3) Pfam (3) All databases (5) Download RDF

DBGET integrated database retrieval system