KEGG   Methanocaldococcus jannaschii: MJ_1388
Entry
MJ_1388           CDS       T00003                                 

Definition
(GenBank) adenosylhomocysteinase (ahcY)
  KO
K01251  adenosylhomocysteinase [EC:3.3.1.1]
Organism
mja  Methanocaldococcus jannaschii
Pathway
mja00270  Cysteine and methionine metabolism
mja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MJ_1388
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mja01009]
    MJ_1388
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mja04147]
    MJ_1388
Enzymes [BR:mja01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.1  Thioether and trialkylsulfonium hydrolases
    3.3.1.1  adenosylhomocysteinase
     MJ_1388
Protein phosphatases and associated proteins [BR:mja01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MJ_1388
Exosome [BR:mja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MJ_1388
SSDB
Motif
Pfam: AdoHcyase AdoHcyase_NAD 2-Hacid_dh_C IlvN AlaDh_PNT_C Pyr_redox_2 TrkA_N
Other DBs
NCBI-ProteinID: AAB99397
UniProt: Q58783
Position
1335803..1337050
AA seq 415 aa
MYEVRDINLWKEGERKIQWAKQHMPVLNLIRERFKEEKPFKGITIGMALHLEAKTAVLAE
TLMEGGAEIAITGCNPLSTQDDVAAACAKKGMHVYAWRGETVEEYYENLNKVLDHKPDIV
IDDGCDLIFLLHTKRTELLDNIMGGCEETTTGIIRLKAMEKEGALKFPVMDVNDAYTKHL
FDNRYGTGQSALDGILRATNLLIAGKTVVVAGYGWCGRGVAMRAKGLGAEVVVTEVNPIR
ALEARMDGFRVMKMEKAAEIGDIFITTTGCKDVIRKEHILKMRNGAILANAGHFDNEINK
KHLEELAKSIKEVRNCVTEYDLGNKKIYLLGEGRLVNLACADGHPCEVMDMSFANQALAA
EYILKNHEKLEPRVYNIPYEQDLMIASLKLKAMGIEIDELTKEQKKYLEDWREGT
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgtatgaagttagggacataaacctctggaaagaaggagagagaaaaatacaatgggca
aaacaacacatgcctgttttaaatttaattagagaaagatttaaagaagaaaagccattt
aaaggaataacaataggaatggctctacacttagaagcaaaaacagctgttttagcagag
acattgatggaaggaggggcagagattgctataactggatgcaatcctttatccactcag
gatgatgttgccgctgcttgtgctaaaaaaggaatgcatgtttatgcatggagaggagag
acagtagaggagtattatgaaaacctaaacaaggttttagaccacaaaccagatattgtt
atagatgatggctgtgatttaatatttttattgcatacaaagagaactgaacttttggat
aacataatgggaggttgtgaagaaactacaactggaatcatcagattaaaagctatggaa
aaagaaggagctttaaaatttccagttatggatgtaaatgatgcatatacgaaacatcta
tttgacaacagatatggaactgggcaaagtgccttagatggaattctgagagctacaaac
ttattaattgctggaaagactgttgttgttgctggttatggatggtgtggtagaggagta
gcaatgagagctaaaggcttaggagcagaggtcgtagttacagaagttaatccaattaga
gccttagaggcaagaatggatggatttagagtcatgaagatggagaaagctgcggagatt
ggagatatatttataacaacaactggatgtaaggatgttattagaaaggaacatatattg
aagatgaggaatggagctatcttagcaaatgctggacactttgacaatgagattaataaa
aagcacttagaagagttagctaaatcaataaaagaagttagaaattgtgtaactgaatac
gacttaggaaataagaaaatatatttattgggagagggtaggttggttaatttggcatgt
gcagatgggcatccatgtgaggttatggacatgagttttgccaaccaagctttagcggct
gaatacatcttaaaaaatcatgagaagttagagccaagggtttataacattccttacgaa
caggacttaatgattgcctctctaaaattgaaagctatgggtattgaaattgatgaacta
actaaagagcaaaaaaaatatttagaagattggagagaaggaacttaa

DBGET integrated database retrieval system