KEGG   Mycobacterium sp. JLS: Mjls_1658
Entry
Mjls_1658         CDS       T00482                                 

Name
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K18257  cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase [EC:1.3.1.49]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00624  Polycyclic aromatic hydrocarbon degradation
mjl01100  Metabolic pathways
mjl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mjls_1658
Enzymes [BR:mjl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.49  cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase
     Mjls_1658
SSDB
Motif
Pfam: adh_short adh_short_C2
Other DBs
NCBI-ProteinID: ABN97451
UniProt: A0A5Q5CE06
Position
1760931..1761836
AA seq 301 aa
MGRCRATRALRITGGTIVLSWLTGQVALVTGGAAGIGLAVVERFLAEGACVGVLDRSEGD
LATIGNADGRLIAVTGDVTSYADNVMAVRETVDAFGKLDVFVGNAGIFDYFAPLVGFDGA
DLSSAFDEIFAVNVKGYLLGARAAVPELLKSDGPSMIFTVSNSGFYAAGGGPLYTASKHA
VVGVVRELAYELAPKIRVNGVAPGGTVTGLRGIEDLGQGQDVLSSVPGIADIMSTTNPLQ
YAQQPADHAGLYLLLASADNSRAVTGVVINSDGGLGVRGLNQPSGGTELATGAMRIDVGS
T
NT seq 906 nt   +upstreamnt  +downstreamnt
gtgggcagatgcagagcaacaagagcattgcgcatcaccggagggacgatagttttgagt
tggttgaccgggcaagtcgccctggtgaccggcggggcagccggaatcggtttggccgtg
gtcgagcgtttcttggccgagggcgcatgcgtgggcgtcctggatcgctcggaaggcgac
ctggctaccatcggcaacgccgacggcaggctcatcgcggtaacaggtgacgtgacgtcg
tatgcagacaacgtcatggcggtgcgcgaaacggtcgatgcgttcggaaagctcgacgtc
ttcgtcggcaacgctgggatcttcgattactttgcccctttggtgggtttcgacggagcc
gacctcagcagcgccttcgatgagatcttcgcggtcaatgtaaagggctacctccttggt
gccagggccgccgttcctgaactcctcaaaagcgatggcccgagcatgatcttcaccgtc
tccaactctggcttctatgccgccggtggcggcccgctgtacaccgcttccaagcacgcg
gtcgttggcgtagtgcgtgaactggcctacgagttggcgccgaagatcagggtgaatggc
gtcgctccaggcggcacggtaacgggcctgcgtggaatcgaggacctcggccagggtcag
gacgtgttgtcatcggtgcccggcatcgccgacattatgagtactacaaacccattgcag
tacgcgcagcagcccgccgatcacgccggcctgtatctgctactcgcgtcggcagacaac
tcgcgagcggtgaccggcgtcgtcatcaacagcgacggcggcttgggcgtgcggggcctc
aaccagccgtccggagggacggaacttgccaccggcgcgatgcgcatcgacgtcgggtca
acatag

DBGET integrated database retrieval system