KEGG   Mesorhizobium jarvisii: EB229_14205
Entry
EB229_14205       CDS       T06715                                 

Name
(GenBank) N-acyl homoserine lactonase family protein
  KO
K18610  4-pyridoxolactonase [EC:3.1.1.27]
Organism
mjr  Mesorhizobium jarvisii
Pathway
mjr00750  Vitamin B6 metabolism
mjr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mjr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    EB229_14205
Enzymes [BR:mjr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.27  4-pyridoxolactonase
     EB229_14205
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2
Other DBs
NCBI-ProteinID: QKC63331
UniProt: A0A6M7TE97
Position
2869595..2870401
AA seq 268 aa
MSDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMK
VLPFEKPIQEKHQTIPGALALLGLEPKDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEV
PQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLAKGVKLI
STPGHSIGHYSLLVEFPKRKPIMFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKL
AEDHGAELMYSHDMENFKTYRTGTQFYG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtcggataccaaagtctacctgctcgacggcggctcgctcgttctcgacggctaccac
gtgttctggaaccgaggccctggcggcgaagtgcgcttccccgtctattcgatcctgatc
gagcatgccgagggccggttcctgatcgacaccggctacgactacgatcacgtcatgaag
gtgctgcccttcgagaagccgatccaggaaaagcaccagaccatccccggcgcgcttgcg
ctgctcggcctcgagccgaaggatatcgacgtcgtcgtcaactcgcatttccatttcgac
cattgcggcggcaacaagtattttccgcatgccaagaagatctgccatcgctcggaggtg
ccgcaggcctgcaatccgcagcctttcgaacatctcggctattcggacctgagcttctcg
gcggaggccgccgaagcgcgaggcgcgacggcgcaactgctggaaggcacgacgcgcgcc
aactcgaccttcgagggcatcgacggcgacgtcgatctcgccaagggcgtcaagctgatc
tcgacgcccggccattcgatcggccactacagcctgctggtcgagttccccaagcgcaag
ccgatcatgttcaccatcgacgccgcctacacccagaagagcctggagacgctgtgccag
gctgccttccacatcgacccggtggcaggcgtcaattcgatgcgcaaggtgaagaagctc
gccgaggaccatggcgccgagctgatgtactcgcacgacatggaaaacttcaagacctac
aggaccggcacgcaattctacggctga

DBGET integrated database retrieval system