KEGG   Methanopyrus kandleri: MK0475
Entry
MK0475            CDS       T00078                                 
Symbol
ehaC
Name
(GenBank) Uncharacterized membrane protein, conserved in archaea
  KO
K14094  energy-converting hydrogenase A subunit C
Organism
mka  Methanopyrus kandleri
Brite
KEGG Orthology (KO) [BR:mka00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    MK0475 (ehaC)
SSDB
Motif
Pfam: DUF2109
Other DBs
NCBI-ProteinID: AAM01690
UniProt: Q8TY31
Position
complement(435497..435760)
AA seq 87 aa
MISAQAVMAAIVILMSLRLLVARDLYAQMLYLNVVGFGLAGLVATTWRTDMGLIAALCVF
IFSTLESNAVSYTIQKIEEIRRAGELD
NT seq 264 nt   +upstreamnt  +downstreamnt
gtgatctccgcacaggcggtgatggcggccatcgtaatcctgatgtcactgcgcctcctg
gtggcgagggatctttacgctcaaatgctctatctcaacgtggtcgggttcggactcgcg
ggtctcgtagcgacgacgtggcgcaccgacatgggtctgatagcggccctgtgtgtgttc
atcttctcaacgctcgagtccaatgccgtctcctacacgatccaaaagatcgaggagatc
agaagggcgggcgagttggattga

DBGET integrated database retrieval system