KEGG   Mycobacterium sp. KMS: Mkms_1650
Entry
Mkms_1650         CDS       T00442                                 

Name
(GenBank) phthalate 3,4-dihydrodiol dehydrogenase
  KO
K18255  phthalate 3,4-cis-dihydrodiol dehydrogenase [EC:1.3.1.-]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00624  Polycyclic aromatic hydrocarbon degradation
mkm01100  Metabolic pathways
mkm01120  Microbial metabolism in diverse environments
mkm01220  Degradation of aromatic compounds
Module
mkm_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mkm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mkms_1650
Enzymes [BR:mkm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-  
     Mkms_1650
SSDB
Motif
Pfam: adh_short adh_short_C2 TrkA_N Epimerase NAD_binding_7
Other DBs
NCBI-ProteinID: ABL90857
UniProt: A1UDE9
Position
1765441..1766244
AA seq 267 aa
MTGWLAGKRALIVGGGSGIGRATVDAFLNEDARVAVLEYDSGKCATLRQQLPDVPVIEGD
GTTRTANDEAVQVAVDAFGGLDTLVNCVGIFDFYRRIQDIPAERIDQAFDEMFRINVLSH
IHSVKAAVPALMGQDGASIVLTESASSFYPGRGGLLYVASKFAVRGVVTALAHELAPRIR
VNGVAPGGTLNTDLRGLDSLDLGARRLDAAPDRARELAARTPLGVALSGHDHAWSYVFLA
SHRSRGLTGETIHPDGGFSLGPPPQRN
NT seq 804 nt   +upstreamnt  +downstreamnt
atgactggctggctggcgggcaaacgcgcattgatcgtcggcggaggttcgggtatcggt
cgggccaccgtcgacgcgttcctgaacgaggatgcccgggtggccgtgctcgagtacgac
agcggtaagtgcgccacgctgcgccagcagctgcccgacgttccggtgatcgagggcgat
gggaccacccgcaccgccaacgacgaagcagtgcaggtcgctgtcgacgccttcggcgga
ctcgacacattggtgaactgcgtggggattttcgatttctaccgccgtattcaggacatc
cccgccgagcgaatcgaccaggcgttcgacgaaatgtttcgcatcaacgtcctgagtcat
atccactcagtcaaggcagcagtgccggcgctgatgggccaggacggcgcctcgatcgtg
ctcaccgagtccgcgtcatcgttctatccaggacgcggcggcctgctgtatgtggcgtcg
aagttcgcggtgcgcggcgtagtcactgcactggctcacgaactcgcgccgaggatccgt
gtgaacggtgtcgcccccggggggacgttgaacaccgacctgcgcggactcgacagcctc
gaccttggcgcccgccgtctggatgctgcaccagatcgggcccgcgaattggctgcccgc
acaccgctgggcgtggccctatcgggtcacgaccacgcgtggagttacgtcttcctcgct
tctcaccgctcccgcgggctcaccggcgaaacgatccatcccgacggcggtttcagcctc
ggacccccaccccagcggaattga

DBGET integrated database retrieval system