KEGG   Mycobacterium sp. KMS: Mkms_1714
Entry
Mkms_1714         CDS       T00442                                 

Name
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K18257  cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase [EC:1.3.1.49]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00624  Polycyclic aromatic hydrocarbon degradation
mkm01100  Metabolic pathways
mkm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mkm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mkms_1714
Enzymes [BR:mkm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.49  cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase
     Mkms_1714
SSDB
Motif
Pfam: adh_short adh_short_C2
Other DBs
NCBI-ProteinID: ABL90917
UniProt: A1UDK9
Position
1830856..1831761
AA seq 301 aa
MGRCRATRALRITGGTIVLSWLTGQVALVTGGAAGIGLAVVERFLAEGACVGVLDRSEGD
LATIGNADGRLIAVTGDVTSYADNVMAVRETVDAFGKLDVFVGNAGIFDYFAPLVGFDGA
DLSSAFDEIFAVNVKGYLLGARAAVPELLKSDGPSMIFTVSNSGFYAAGGGPLYTASKHA
VVGVVRELAYELAPKIRVNGVAPGGTVTGLRGIEDLGQGQDVLSSVPGIADIMSTTNPLQ
YAQQPADHAGLYLLLASADNSRAVTGVVINSDGGLGVRGLNQPSGGTELATGAMRIDVGS
T
NT seq 906 nt   +upstreamnt  +downstreamnt
gtgggcagatgcagagcaacaagagcattgcgcatcaccggagggacgatagttttgagt
tggttgaccgggcaagtcgccctggtgaccggcggggcagccggaatcggtttggccgtg
gtcgagcgtttcttggccgagggcgcatgcgtgggcgtcctggatcgctcggaaggcgac
ctggctaccatcggcaacgccgacggcaggctcatcgcggtaacaggtgacgtgacgtcg
tatgcagacaacgtcatggcggtgcgcgaaacggtcgatgcgttcggaaagctcgacgtc
ttcgtcggcaacgctgggatcttcgattactttgcccctttggtgggtttcgacggagcc
gacctcagcagcgccttcgatgagatcttcgcggtcaatgtaaagggctacctccttggt
gccagggccgccgttcctgaactcctcaaaagcgatggcccgagcatgatcttcaccgtc
tccaactctggcttctatgccgccggtggcggcccgctgtacaccgcttccaagcacgcg
gtcgttggcgtagtgcgtgaactggcctacgagttggcgccgaagatcagggtgaatggc
gtcgctccaggcggcacggtaacgggcctgcgtggaatcgaggacctcggccagggtcag
gacgtgttgtcatcggtgcccggcatcgccgacattatgagtactacaaacccattgcag
tacgcgcagcagcccgccgatcacgccggcctgtatctgctactcgcgtcggcagacaac
tcgcgagcggtgaccggcgtcgtcatcaacagcgacggcggcttgggcgtgcggggcctc
aaccagccgtccggagggacggaacttgccaccggcgcgatgcgcatcgacgtcgggtca
acatag

DBGET integrated database retrieval system