KEGG   Methanocorpusculum labreanum: Mlab_0562
Entry
Mlab_0562         CDS       T00472                                 
Name
(GenBank) hypothetical protein
  KO
K14094  energy-converting hydrogenase A subunit C
Organism
mla  Methanocorpusculum labreanum
Brite
KEGG Orthology (KO) [BR:mla00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    Mlab_0562
SSDB
Motif
Pfam: DUF2109
Other DBs
NCBI-ProteinID: ABN06736
UniProt: A2SQY0
Position
536084..536323
AA seq 79 aa
MIVEGICVVIAAYCASRAVFEPKTLKKLPYLNVMNFAVAGAIVLLMPYPITIGAAIAYFI
GSTLESNAIASTFARLEEQ
NT seq 240 nt   +upstreamnt  +downstreamnt
atgatcgttgagggaatatgtgtggtcatcgcagcatactgtgcgagtcgtgcggttttc
gagccgaaaacgctgaaaaaactgccgtatctcaacgtgatgaactttgccgtggccgga
gcgatcgtccttctgatgccgtatcccataacgataggcgccgcaattgcgtatttcatc
ggctcgactcttgaatcgaacgccatagcaagtacctttgcccggctggaggaacaatga

DBGET integrated database retrieval system