KEGG   Mesorhizobium loti NZP2037: A9174_14090
Entry
A9174_14090       CDS       T04711                                 

Name
(GenBank) MBL fold metallo-hydrolase
  KO
K18610  4-pyridoxolactonase [EC:3.1.1.27]
Organism
mln  Mesorhizobium loti NZP2037
Pathway
mln00750  Vitamin B6 metabolism
mln01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mln00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    A9174_14090
Enzymes [BR:mln01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.27  4-pyridoxolactonase
     A9174_14090
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2
Other DBs
NCBI-ProteinID: ANN57776
Structure
PDB: 
3AJ3

Position
2941564..2942370
AA seq 268 aa
MSDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMK
VLPFEKPIQEKHQTIPGALALLGLEPKDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEV
PQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLAKGVKLI
STPGHSIGHYSLLVEFPKRKPIMFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKL
AEDHGAELMYSHDMENFKTYRTGTQFYG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtcggataccaaagtctacctgctcgacggcggctcgctcgttctcgacggctaccac
gtgttctggaaccgaggccctggcggcgaagtgcgcttccccgtctattcgatcctgatc
gagcatgccgagggccggttcctgatcgacaccggctacgactacgatcacgtcatgaag
gtgctgcccttcgagaagccgatccaggaaaagcaccagaccatccccggcgcgcttgcg
ctgctcggcctcgagccgaaggatatcgacgtcgtcgtcaactcgcatttccatttcgac
cattgcggcggcaacaagtattttccgcatgccaagaagatctgccatcgctcggaggtg
ccgcaggcctgcaatccgcagcctttcgaacatctcggctattcggacctgagcttctcg
gcggaggccgccgaagcgcgaggcgcgacggcgcaactgctggaaggcacgacgcgcgcc
aactcgaccttcgagggcatcgacggcgacgtcgatctcgccaagggcgtcaagctgatc
tcgacgcccggccattcgatcggccactacagcctgctggtcgagttccccaagcgcaag
ccgatcatgttcaccatcgacgccgcctacacccagaagagcctggagacgctgtgccag
gctgccttccacatcgacccggtggcaggcgtcaattcgatgcgcaaggtgaagaagctc
gccgaggaccatggcgccgagctgatgtactcgcacgacatggaaaacttcaagacctac
aggaccggcacgcaattctacggctga

DBGET integrated database retrieval system