KEGG   Mesorhizobium japonicum MAFF 303099: mlr6805
Entry
mlr6805           CDS       T00043                                 

Name
(GenBank) hypothetical protein
  KO
K18610  4-pyridoxolactonase [EC:3.1.1.27]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00750  Vitamin B6 metabolism
mlo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    mlr6805
Enzymes [BR:mlo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.27  4-pyridoxolactonase
     mlr6805
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2
Other DBs
NCBI-ProteinID: BAB53031
RhizoBase: mlr6805
UniProt: Q988B9
Structure
PDB: 
4KEP 4KEQ

Position
5601637..5602443
AA seq 268 aa
MSDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMK
VLPFEKPIQEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEV
PQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLARGVKLI
STPGHSIGHYSLLVEFPRRKPILFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKL
AEDHGAELMYSHDMDNFKTYRTGTQFYG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtcggatacaaaggtctacctgctcgacggcggctcgctcgttctcgacggctatcac
gtgttctggaaccggggccctggtggcgaagtgcgcttccccgtctattcgatcctgatc
gagcatgccgagggccggttcctcatcgacaccggctacgactacgatcacgtcatgaag
gtgctgcccttcgagaagccgatccaggaaaagcatcagaccatccccggcgcgcttggc
ctgctcgggctcgagcccagggatatcgacgtcgtcgtcaattcgcatttccatttcgac
cattgcggcggcaacaagtattttccacacgccaagaagatctgccatcgctcggaggtg
ccgcaggcctgcaatccgcagcctttcgaacatctcggctattccgacctgagcttctcg
gcggaggccgccgaagcccgcggcgcgaccgcgcaactgctggaaggcacgacgcgcgcc
aactcgaccttcgagggcatcgacggcgacgtcgatctcgccaggggcgtgaagctgatc
tcgacgccaggccattcgatcggccactacagcctgctggtcgaattccccaggcgcaag
ccgatcctattcaccatcgacgccgcctacacccagaagagcctggagacgctgtgccag
gcagctttccacatcgacccggtagcgggcgtcaattcgatgcgcaaggtaaagaagctc
gccgaggaccatggcgccgagctgatgtactcgcacgacatggacaacttcaagacctac
aggaccggcacgcaattctacggctga

DBGET integrated database retrieval system