KEGG   Methanosarcina lacustris: MSLAZ_3207
Entry
MSLAZ_3207        CDS       T03822                                 

Name
(GenBank) ferredoxin
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
mls  Methanosarcina lacustris
Brite
KEGG Orthology (KO) [BR:mls00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MSLAZ_3207
Enzymes [BR:mls01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     MSLAZ_3207
SSDB
Motif
Pfam: RACo_C_ter Raco_middle Fer4 Fer4_21 Fer4_6 Fer4_7 Fer4_9 Fer4_16 Fer4_2 Fer4_10 Fer4_17 Fer4_3 Fer4_8 Fer4_4 Fer4_13
Other DBs
NCBI-ProteinID: AKB76468
UniProt: A0A0E3SB45
Position
4119140..4120765
AA seq 541 aa
MYGIALDLGTSGFRAQLIDLETKETLKTVITMGHPLPGGNVMDHLDFAITTGEDVAHGVI
IETIRRMFLKFNADLSKVERLAVCGNPIQLSLFQNLEIRDLAYAGENKQKMLGVQNVKRD
ARVFPASELFGDTDLPNCEVIVPPAIRHEIGADALAMMLETDFLSQTEPALVTDYGTNAE
MALKVGDRIITASAAAGPAIEGQGISSGMLASPGAICDVKPEGEYWKIIVLDKEMEKQDA
YLIHPVTGEIKESYGGEAVGITGTGVISAFSLAMRSGLITKSPKLPNGKLILGPGIEITE
KDVEEAGKAIGAIRAAHMTLIVESGIKYEDLEYAYMSGASGAYVDAEAARRLGAAPGYAK
KIVQFGNTSLALARELVLNKSRLDDVIEVAKRITADHLMMATSDTFNNFYLCELSYWTMG
MPLEMYDQMLELYGLPKLPKTLEHATIEKRVSKDIEQVGVGGLAILKEIGIILEVPVDKC
IYCQKCVEECPEDALEIVETDGKRIAKYDSQKCLGTSCRRCVSVCPENAIDITKLRIKGT
K
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgtacggaatagcacttgacctgggtaccagcggttttagagcccagcttattgatctt
gaaacgaaagaaaccttaaaaacagtcataaccatgggtcatcccctccccggaggaaat
gtcatggaccacctggattttgcaatcacaacaggtgaggatgtggctcacggagtaatt
atcgaaaccatcaggaggatgttcctgaaattcaatgccgacctttcgaaggtggaaagg
cttgcagtctgtggaaaccctatccagctttcccttttccagaatctcgaaataagggac
cttgcatacgccggggaaaacaaacagaaaatgctcggagtccagaatgtaaaaagagat
gcccgtgtatttccagcctccgaacttttcggagatacggatttgcctaattgtgaagtc
atcgtaccccctgcgatcaggcatgagatcggagccgacgcccttgccatgatgctggaa
actgatttccttagccagaccgaacctgcactggttacagattacggtacaaacgccgaa
atggctctcaaggtcggggacaggattatcactgcaagtgctgccgcaggccctgcgatt
gaaggacagggcataagttccggcatgcttgcaagcccaggggcaatctgtgacgtgaaa
cccgaaggcgaatactggaaaattatagtccttgataaagagatggaaaagcaggacgcc
taccttatccatccggtcacaggtgagattaaggagtcctatggtggggaagccgtgggc
atcacaggtaccggggtcatctcggctttttccctggccatgagaagtgggctgataaca
aaatcaccgaaacttcccaatgggaagctgattcttggtcctggaattgaaatcactgaa
aaggacgtcgaagaagccggaaaagccataggggcgatccgtgcagctcacatgactctt
atcgtggagtccggaataaagtatgaagaccttgagtatgcatacatgtcaggggcttcc
ggtgcctatgtagacgctgaagctgcccgcaggctcggggccgccccgggttatgccaaa
aaaattgtccagttcggaaacacctcccttgcccttgcccgggaacttgtactgaacaag
tccaggctggatgatgtaatcgaggttgcaaaaagaattactgccgaccacctcatgatg
gcgaccagcgatacctttaataacttctatctctgcgaactctcctactggaccatggga
atgccgcttgaaatgtacgaccagatgcttgaactctacggattgcccaaactcccgaaa
accctggaacacgccaccatcgaaaagcgagttagtaaggatatagagcaggtcggagtc
ggcgggcttgccatcctcaaagaaataggcataatcctcgaagtccctgtggataagtgc
atctactgccagaaatgcgtagaagaatgccctgaagacgccctcgaaatcgtcgaaacc
gacggcaaaaggatcgcaaaatacgacagccagaaatgtctcggcacaagctgccgccgt
tgtgttagcgtctgccccgaaaatgccatcgacatcaccaaactccgcatcaaagggaca
aaataa

DBGET integrated database retrieval system