KEGG   Methanosarcina mazei Go1: MM_1440
Entry
MM_1440           CDS       T00082                                 

Name
(GenBank) conserved protein
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
mma  Methanosarcina mazei Go1
Brite
KEGG Orthology (KO) [BR:mma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MM_1440
Enzymes [BR:mma01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     MM_1440
SSDB
Motif
Pfam: RACo_C_ter Fer4 Raco_middle Fer4_6 Fer4_21 Fer4_7 Fer4_9 Fer4_16 Fer4_10 Fer4_2 Fer4_3 Fer4_8 Fer4_4
Other DBs
NCBI-ProteinID: AAM31136
UniProt: Q8PWY6
Position
1721763..1723385
AA seq 540 aa
MYGIALDLGTSGFRAQLIDLETDETLKTVITMGHPLPGGNVMDHLDFAITTGEDVAHGVI
IETIRRMFLKFDADLSKVERLAVCGNPIQLSLFQNIEIRDLAYAGENKQKMLGVQNVTRD
SRVFPASDIFGDDFFRGCEIIVPPAIKHEIGADALAMMLETDFLIQTEPALVTDYGTNAE
MALKVGDRIITASAAAGPAIEGQGISSGMLASPGAICDVKPEGEYWKVMVLDNEMEKQDA
YLINPVTGEMKETNGYEAAGITGTGVISAFALALRSGLVEKPPKLPNGKLILGPGIEITE
KDVEEAGKAIGAIRAAHMTLIVESGIKYEDLEYAYMSGASGAYVDAEDARRLGAVPGYAK
KIVQFGNTSLALARELVLDKSRLDDVIKIAKKITADHLMMATSNTFNNFYLCELSYWTMG
MPLEMYNQMLELYGLPKLPETLEHVSIEKRVSKDIEQVGVGGLALLKEIGIILEVPVEKC
IYCQKCMEECPENALEITETDGIRTAKYDSQKCLGTSCRRCVSVCPENAIDITKLRIKAK
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgtacggaattgcacttgacctgggtaccagcggttttagagcccagcttatcgacctt
gaaacagatgagaccttaaaaacagttattaccatgggtcaccccctgccaggaggaaat
gttatggaccacctggactttgctatcacaacaggggaagacgtggctcatggagtgatt
attgaaaccatcaggaggatgttcctgaaatttgatgcagacctttcaaaagtggaaagg
ctcgcagtctgcggaaaccctatccagctttctctttttcagaacatcgaaataagggac
cttgcatatgccggagaaaacaaacagaaaatgctcggagtccagaatgtaacacgagat
tcccgtgtatttccggcttcggacattttcggggatgatttttttcgcggctgtgaaatc
atcgtacccccggcaatcaaacatgagataggagctgatgcccttgccatgatgctggaa
accgattttctgatccagaccgaacctgcactggtgacggattatggaacaaatgcggaa
atggctctcaaagttggcgacaggataataactgcaagtgctgcggcaggtcctgcgatc
gaggggcagggcataagttcgggaatgcttgcaagccccggggcaatctgtgacgtaaag
cctgaaggcgaatactggaaagtcatggtcctcgataatgagatggaaaaacaggacgct
taccttattaaccctgtaaccggcgaaatgaaagaaacgaacggatatgaagctgcaggc
atcacagggacgggagtaatctcggcttttgccctggctctgagaagcgggctggttgaa
aagcctccaaaactccccaatgggaaactgattctgggccccgggattgaaattactgaa
aaggatgtcgaagaagccggaaaagcaataggtgcgatccgtgccgctcacatgactctc
atagtggagtccggaattaaatacgaagatcttgaatacgcatacatgtcaggggcatca
ggagcttatgtagacgccgaagatgcccgcaggcttggtgcagttccgggttatgcaaaa
aaaatagtccagttcggaaacacctctctcgcccttgcgcgggaacttgtgcttgacaag
tccaggcttgatgatgtcatcaaaatcgcaaaaaagatcactgctgaccacctgatgatg
gcaacaagcaatactttcaacaacttctatctgtgtgaactctcttactggacaatggga
atgcctcttgaaatgtacaaccagatgcttgaactctacgggctccccaaactccctgaa
actcttgaacacgttagtatagaaaaacgggtaagtaaggatatagagcaggtaggagtc
ggcggtcttgccctcctgaaagaaataggcattatccttgaagtccccgtagagaaatgt
atctactgccagaaatgcatggaagaatgccctgaaaacgctctggaaatcaccgagacc
gatgggataagaaccgcaaaatacgacagccagaaatgccttggaacaagctgccgccgc
tgtgtcagtgtctgccccgaaaatgcaattgacataacaaaactgagaatcaaagcaaaa
taa

DBGET integrated database retrieval system