KEGG   Mycolicibacterium mageritense: MMAGJ_45170
Entry
MMAGJ_45170       CDS       T07395                                 

Symbol
hcaB
Name
(GenBank) 3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase
  KO
K18257  cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase [EC:1.3.1.49]
Organism
mmat  Mycolicibacterium mageritense
Pathway
mmat00624  Polycyclic aromatic hydrocarbon degradation
mmat01100  Metabolic pathways
mmat01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmat00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    MMAGJ_45170 (hcaB)
Enzymes [BR:mmat01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.49  cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase
     MMAGJ_45170 (hcaB)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR 3Beta_HSD Epimerase NAD_binding_10 TrkA_N 2-Hacid_dh_C NAD_binding_7 Polysacc_synt_2
Other DBs
NCBI-ProteinID: BBX35235
Position
complement(4643818..4644633)
AA seq 271 aa
MTDGWLTGKTVVVTGGGTGIGRAVVDRFVAEGARVSVLDRDGDAVTELRARQNVWATEGD
VRRYGDHQRCVAETVREFGGIDVLVTVAGIFDYFASLESLPEDNLDAAFSEMFDVNVKGT
LLAVKAALPELQKSRGNVVLTISNAGYLPGGGGPLYTGSKFAVRGLLAQLSFELAPDIRV
NAVAPGGTVTALRGLEATATGEQRLVDMPDLPTLIRRTNPLQVASEPADHAWAYVYLACK
ERTKSVTGCVINSDGGLHSRGLVPLGGELIS
NT seq 816 nt   +upstreamnt  +downstreamnt
gtgaccgatggctggctgacgggcaagaccgtggtggtcaccggcggcggcaccggaatc
ggccgggcggtcgtcgaccggttcgtggctgaaggcgcacgggtttcggtgctcgaccgc
gacggcgatgcggtcaccgaacttcgtgcgcgccagaatgtatgggccaccgagggggat
gtgcgacggtacggcgaccaccagcggtgtgtcgcagagacggtgcgcgagttcggcggc
atcgatgtgctcgtcacggtcgcggggatcttcgactacttcgcatcgctggaaagcctc
cccgaagacaacctcgatgcggcgttcagcgagatgttcgacgtgaatgtcaaagggaca
ctgctggcggtgaaagctgcgctgcccgaactccaaaagtcgcgaggcaacgtcgtcctg
accatctccaacgccggctacctgccgggcggcggcgggccgctctacaccgggtcgaag
ttcgccgtacgcggcctgctggcgcagctgtctttcgaactcgcgccggacatccgggtc
aacgcggtggcaccgggcggcaccgtcacagcgctgcgcggcctggaggcgacggctacc
ggggaacagcgtctggtcgacatgccggacctgccgacgctgatccgccgcaccaaccca
ctgcaggtcgcctccgaacccgccgaccacgcctgggcctatgtgtaccttgcctgcaag
gaacgcacgaagtcggtcaccggctgcgtgatcaactccgacggcggcctgcacagccgc
ggcctggttccgcttggcggcgaactgatctcctga

DBGET integrated database retrieval system