KEGG   Methanosarcina mazei Tuc01: MmTuc01_1498
Entry
MmTuc01_1498      CDS       T02477                                 

Name
(GenBank) Methyltransferase corrinoid activation protein MA0150
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
mmaz  Methanosarcina mazei Tuc01
Brite
KEGG Orthology (KO) [BR:mmaz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MmTuc01_1498
Enzymes [BR:mmaz01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     MmTuc01_1498
SSDB
Motif
Pfam: RACo_C_ter Fer4 Raco_middle Fer4_6 Fer4_21 Fer4_7 Fer4_9 Fer4_16 Fer4_10 Fer4_2 Fer4_3 Fer4_8 Fer4_4
Other DBs
NCBI-ProteinID: AGF96867
UniProt: M1P8T1
Position
1484067..1485689
AA seq 540 aa
MYGIALDLGTSGFRAQLIDLETNETLKTVITMGHPLPGGNVMDHLDFAITTGEDVAHGVI
IETIRRMFLKFDADLSKVERLAVCGNPIQLSLFQNIEIRDLAYAGENKQKMLGVQNVTRD
SRVFPASDIFGDDFFRGCEIIVPPAIKHEIGADALAMMLETDFLIQTEPALVTDYGTNAE
MALKVGDRIITASAAAGPAIEGQGISSGMLASPGAICDVKPEGEYWKVMVLDNEMEKQDA
YLINPVTGEMKETNGYEAAGITGTGVISAFALALRSGLVEKPPKLPNGKLILGPGIEITE
KDVEEAGKAIGAIRAAHMTLIVESGIKYEDLEYAYMSGASGAYVDAEDARRLGAVPGYAK
KIVQFGNTSLALARELVLDRSRLDDVIKIAKKITADHLMMATSNTFNNFYLCELSYWTMG
MPLEMYNQMLELYGLPKLPETLEHVSIEKRVSKDIEQVGVGGLALLKEIGIILEVPVEKC
IYCQKCMEECPENALEITETDGIRTAKYDSQKCLGTSCRRCVSVCPENAIDITKLRIKAK
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgtacggaattgcacttgacctgggtaccagcggttttagagcccagcttatcgacctt
gaaacaaatgagaccttaaaaacagtcattaccatgggtcaccctctgccaggaggaaat
gttatggaccacctggactttgctatcacaacaggggaagacgtggctcatggagtgatt
attgaaaccatcaggaggatgtttctgaaattcgatgcagacctttcaaaagtggaaagg
ctcgcagtctgtgggaaccctatccagctttctctttttcagaacatcgaaataagggac
cttgcatatgccggagaaaacaaacagaaaatgctcggagtccagaatgtaacacgagat
tcccgtgtatttccggcttcggacattttcggggatgatttttttcgcggctgtgaaatc
atcgtacccccggcaatcaaacatgagataggagctgatgcccttgccatgatgctggaa
accgattttctgatccagaccgaacctgcactggtgacggattatggaacaaatgcggaa
atggctctcaaagttggcgacaggataataactgcaagtgctgcggcaggtcctgcgatc
gaggggcagggcataagttcgggaatgcttgcaagccccggggcaatctgtgacgtaaag
cctgaaggcgaatactggaaagtcatggtcctcgataatgagatggaaaaacaggacgct
taccttattaaccctgtaaccggcgaaatgaaagaaacgaacggatatgaagctgcaggc
atcacagggacgggagtaatctcggcttttgccctggctctgagaagcgggctggttgaa
aagcctccaaaactccccaatgggaaactgattctgggccccgggattgaaattactgaa
aaggatgtcgaagaagccggaaaagcaataggtgcgatccgtgccgctcacatgactctc
atagtggagtccggaattaaatacgaagatcttgaatacgcatacatgtcaggggcatca
ggagcttatgtagacgccgaagatgcccgcaggcttggtgcagttccgggttatgcaaaa
aaaatagtccagttcggaaacacctctctcgcccttgcgcgggaacttgtgcttgacagg
tccaggcttgatgatgtcatcaaaatcgcaaaaaagatcactgctgaccacctgatgatg
gcaacaagcaatactttcaacaacttctatctgtgtgaactctcttactggacaatggga
atgcctcttgaaatgtacaaccagatgcttgaactctacgggctccccaaactccctgaa
actcttgaacacgttagtatagaaaaacgggtaagtaaggatatagagcaggtaggagtc
ggcggtcttgccctcctgaaagaaataggcattatccttgaagtccccgtagagaaatgt
atctactgccagaaatgcatggaagaatgccctgaaaacgctctggaaatcaccgagacc
gatgggataagaaccgcaaaatacgacagccagaaatgccttggaacaagctgccgccgc
tgtgtcagtgtctgccccgaaaatgcaattgacataacaaaactgagaatcaaagcaaaa
taa

DBGET integrated database retrieval system