KEGG   Mycobacterium sp. MCS: Mmcs_1624
Entry
Mmcs_1624         CDS       T00367                                 

Name
(GenBank) phthalate 3,4-dihydrodiol dehydrogenase
  KO
K18255  phthalate 3,4-cis-dihydrodiol dehydrogenase [EC:1.3.1.-]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00624  Polycyclic aromatic hydrocarbon degradation
mmc01100  Metabolic pathways
mmc01120  Microbial metabolism in diverse environments
mmc01220  Degradation of aromatic compounds
Module
mmc_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mmc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mmcs_1624
Enzymes [BR:mmc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-  
     Mmcs_1624
SSDB
Motif
Pfam: adh_short adh_short_C2 TrkA_N Epimerase NAD_binding_7
Other DBs
NCBI-ProteinID: ABG07735
UniProt: A0A5Q5BHH9
Position
1761035..1762090
AA seq 351 aa
MRGTGYAAGRGDRRCTERRQRVRRGRRAPSDHSQRSSAVDSGAKIGAVGLAGCLGDRGAD
LAEPSHLSGHGGERRYSVDSGRRDMTGWLAGKRALIVGGGSGIGRATVDAFLNEDARVAV
LEYDSGKCATLRQQLPDVPVIEGDGTTRTANDEAVQVAVDAFGGLDTLVNCVGIFDFYRR
IQDIPAERIDQAFDEMFRINVLSHIHSVKAAVPALMGQDGASIVLTESASSFYPGRGGLL
YVASKFAVRGVVTALAHELAPRIRVNGVAPGGTLNTDLRGLDSLDLGARRLDAAPDRARE
LAARTPLGVALSGHDHAWSYVFLASHRSRGLTGETIHPDGGFSLGPPPQRN
NT seq 1056 nt   +upstreamnt  +downstreamnt
gtgcgaggaactggctacgctgctggccggggcgaccggcgatgcactgaacgtcgccaa
cgagttcgcagaggtcgtcgtgcgccgagtgaccactcgcaacggagctcggctgttgat
tcaggcgccaaaatcggcgcagtgggtctcgctggatgccttggagatcgaggcgctgac
ctggcagaacccagccaccttagcggccatggtggggaacgcaggtactccgttgattct
gggcgacgagatatgactggctggctggcgggcaaacgcgcattgatcgtcggcggaggt
tcgggtatcggtcgggccaccgtcgacgcgttcctgaacgaggatgcccgggtggccgtg
ctcgagtacgacagcggtaagtgcgccacgctgcgccagcagctgcccgacgttccggtg
atcgagggcgatgggaccacccgcaccgccaacgacgaagcagtgcaggtcgctgtcgac
gccttcggcggactcgacacattggtgaactgcgtggggattttcgatttctaccgccgt
attcaggacatccccgccgagcgaatcgaccaggcgttcgacgaaatgtttcgcatcaac
gtcctgagtcatatccactcagtcaaggcagcagtgccggcgctgatgggccaggacggc
gcctcgatcgtgctcaccgagtccgcgtcatcgttctatccaggacgcggcggcctgctg
tatgtggcgtcgaagttcgcggtgcgcggcgtagtcactgcactggctcacgaactcgcg
ccgaggatccgtgtgaacggtgtcgcccccggggggacgttgaacaccgacctgcgcgga
ctcgacagcctcgaccttggcgcccgccgtctggatgctgcaccagatcgggcccgcgaa
ttggctgcccgcacaccgctgggcgtggccctatcgggtcacgaccacgcgtggagttac
gtcttcctcgcttctcaccgctcccgcgggctcaccggcgaaacgatccatcccgacggc
ggtttcagcctcggacccccaccccagcggaattga

DBGET integrated database retrieval system