KEGG   Martelella mediterranea: Mame_00111
Entry
Mame_00111        CDS       T04757                                 

Name
(GenBank) 4-pyridoxolactonase
  KO
K18610  4-pyridoxolactonase [EC:3.1.1.27]
Organism
mmed  Martelella mediterranea
Pathway
mmed00750  Vitamin B6 metabolism
mmed01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmed00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mame_00111
Enzymes [BR:mmed01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.27  4-pyridoxolactonase
     Mame_00111
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2
Other DBs
NCBI-ProteinID: AQZ49494
UniProt: A0A1U9YVN8
Position
complement(112475..113281)
AA seq 268 aa
MADTKVFLLDGGSLVLDGFHIWWNKGPGGEVRFPVYSVLVDHPKGKFLIDTGYDFDHVQK
VLPFEKPQQTKEQTIPGALKLLGLEPKDIDVLFNSHFHFDHVGGNKFFPDAKKLCHKDEL
PQAAKCQPFEVLGYSDLAFSTDVAEARGMSDQLGAGQTAANTKFELIEGDVELAPGVTLL
YTPGHTVGHYSLLVEFDTRRPLLLTLDAAYTRKNYDNDINAGFHIDPVAGVNSMRRLKEI
EKKTNAEVLFSHDPESFKDYKTGVNFYG
NT seq 807 nt   +upstreamnt  +downstreamnt
atggcagataccaaggtcttcctgctcgacggcggttcgctggtgctcgacggttttcat
atctggtggaacaaggggccgggcggcgaggttcgctttcccgtctattccgtgctcgtc
gatcaccccaagggaaagttcctgatcgataccggttatgatttcgaccatgtgcagaag
gtgctgcccttcgaaaaaccgcagcagaccaaggagcagaccattcccggcgcgctcaag
cttctggggttggagccgaaggacatcgatgtcctgttcaactcgcatttccacttcgat
catgtcggcggcaacaagttcttccccgatgcgaagaagctctgccataaagacgaactc
ccccaggcggccaagtgccagcccttcgaagtgctgggctattccgacctcgccttctcc
accgatgtggcggaagcgcgcggcatgagcgaccagctcggcgccgggcagacggcggca
aacacgaaattcgaactgatcgaaggcgatgtggaactcgccccgggcgtgacgctgctc
tacacaccgggccataccgtcgggcactattcgctgctggtggaattcgacacgcgccgt
ccgctgctgctcacgctcgatgccgcctatacccgcaagaactacgacaatgacatcaat
gcgggcttccacatcgatcccgtggcgggcgtgaactcgatgcgccgcctgaaggaaatc
gagaagaagaccaacgccgaggttctgttcagccacgatcccgaaagcttcaaggactac
aagaccggcgtcaatttctacggttga

DBGET integrated database retrieval system