Methylococcus mesophilus: OOT43_05530 Help Entry OOT43_05530       CDS       T09468                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism mmeo  Methylococcus mesophilus Pathway mmeo02024   Quorum sensing mmeo03018   RNA degradation Brite KEGG Orthology (KO) [BR:mmeo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     OOT43_05530 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     OOT43_05530 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mmeo03019]     OOT43_05530 (hfq)    03036 Chromosome and associated proteins [BR:mmeo03036]     OOT43_05530 (hfq) Messenger RNA biogenesis [BR:mmeo03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      OOT43_05530 (hfq) Chromosome and associated proteins [BR:mmeo03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     OOT43_05530 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  UZR30102 Position complement(1233194..1233442) Genome browser AA seq 82 aa AA seqDB search MSKGQNLQDPFLNTLRKEHVPVSIYLVNGIKLQGKVDSFDQYVIMLKNTVSQMVYKHAIS TIVPGRPVRVPHAGEGGDEDAE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtcgaagggccaaaatctgcaagatccattcctgaacacactccggaaggaacacgtt ccggtttcgatctatctcgtcaacggaatcaagctgcaaggaaaggtggattcgttcgac cagtacgtgatcatgctgaagaacaccgtcagccagatggtgtacaaacacgcgatttcg accatcgtgcccggccgccccgtgcgcgtgccgcatgcgggtgaaggtggcgacgaggat gccgagtga

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (3) Pfam (3) All databases (4) Download RDF

DBGET integrated database retrieval system