KEGG   Methanococcoides methylutens: MCMEM_1861
Entry
MCMEM_1861        CDS       T03913                                 

Name
(GenBank) formate hydrogenlyase complex iron-sulfur subunit
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
mmet  Methanococcoides methylutens
Brite
KEGG Orthology (KO) [BR:mmet00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MCMEM_1861
Enzymes [BR:mmet01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     MCMEM_1861
SSDB
Motif
Pfam: RACo_C_ter Raco_middle Fer4 Fer4_21 Fer4_6 Fer4_7 Fer4_9 Fer4_8 Fer4_16 Fer4_17 Fer4_10 Fer4_2 Fer4_4 Fer4_3 Fer4_11
Other DBs
NCBI-ProteinID: AKB85914
UniProt: A0A0E3X0I2
Position
complement(2023314..2024936)
AA seq 540 aa
MYGIALDLGTSGFRAQLIDLEAKEVLKTAITMRHPLPGGNVMDHLDFAIQVGTDLAHEIM
MDTIAKIFEELDVDTSLVSRLAVCGNPIQLSLFQNMEIRDLAYAGENKQKKLGVENVTRD
ARVFPASELFEGIADLPNCTVIVPPAIKHEIGADALAMMIKTDFMDKDIPSMVTDYGTNA
EMAIKIGDKIITGSAAAGPAIEGQGISCGMLASPGAISDVNPEGDCWRVTVLDGLMNERK
GHLIDPKTGVITEPSEIVAKGVTGTGVIAALSLAIESGIITKIPEIPGGKLILGDKIEIN
EKDIEEAGKAIGAIRAAQLTLMLEAGVEYKDLEFMYMAGATGAYVNADKARKLGSCPNFA
HNIVQFGNTSVALARDLVMDESKLDEVIEVAKKIKADHLMMATSAEFSNIYVCELSYWTQ
GMPIEMYNQMLEMYNLPSLPETYENPGIEKRVAKDIDEVGKEGLKIVSDLGIIIEEKAQE
CILCHKCEEECPEDAITIIERDGEIFANYNSERCLGTSCRRCVSICPVDAIHYKTISIKE
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgtatggtattgcattggatctgggaacaagtggttttcgtgctcaattgatcgacctg
gaagctaaggaggtcttaaagactgctatcactatgaggcatcctcttcctggtgggaac
gttatggaccatctggattttgctattcaggtgggtactgatcttgcacatgagatcatg
atggatacaattgccaaaatatttgaggagcttgatgttgatacctctcttgtcagcaga
cttgctgtttgtggtaatcctatccagttgtctcttttccagaacatggagatcagggat
cttgcatatgctggtgagaacaaacagaagaaacttggtgttgaaaacgttactcgtgat
gcaagggtatttcctgcaagtgaacttttcgaaggcatagcagacttgccaaattgtact
gtgatcgtacctcctgctatcaaacatgagattggcgcagatgcacttgccatgatgatc
aagactgattttatggacaaggatattccttccatggtaactgattatggtaccaatgca
gaaatggctatcaagatcggcgacaagattataaccggcagtgctgcagcaggtcctgcg
attgaaggtcagggtatcagctgtggtatgcttgcaagtccgggtgcaatctctgatgtg
aatcctgagggtgactgttggagagttacggtccttgatggacttatgaacgagcgcaag
ggtcatcttatcgatccgaaaaccggtgtcatcactgaaccttctgagatcgttgcaaaa
ggtgtgaccggaacaggtgttattgctgcgctttcactggcaattgaatctggtattatt
actaagatcccggagattcccgggggcaaacttattctcggggataagatcgagatcaat
gagaaggatattgaagaggcaggaaaggcaattggtgctatcagggctgcccagttgacc
cttatgctggaagcaggtgttgaatataaggatcttgagttcatgtatatggccggtgcc
accggtgcatatgtgaatgcggacaaggcaaggaagcttggttcatgtccaaactttgca
cataatattgttcaattcggtaacacttcagtcgcccttgcaagggatctcgtgatggat
gagtccaaacttgacgaggtcattgaggtggcaaagaagatcaaggcagatcacctgatg
atggctacaagtgctgagttctcaaacatctatgtgtgtgagctttcctactggactcag
ggtatgcctattgagatgtacaaccagatgcttgaaatgtataatcttccttctcttccg
gagacctatgagaatccaggcattgagaagagagttgcaaaggacatcgatgaggtgggt
aaagaaggtctgaagatcgtcagcgatcttggaattatcatcgaagaaaaggcacaggaa
tgtatcctttgtcacaaatgtgaagaggagtgccctgaggacgccattactataatcgaa
cgtgatggtgagatctttgctaactataatagtgaaagatgtcttggtacgagctgcaga
cggtgtgtttccatctgcccggtggatgcaatccattacaagaccatttccattaaggaa
tga

DBGET integrated database retrieval system